KEGG   Ralstonia eutropha JMP134: Reut_A2846Help
Entry
Reut_A2846        CDS       T00268                                 

Definition
(RefSeq) guanine-specific ribonuclease N1 and T1
  KO
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
reu  Ralstonia eutropha JMP134
Brite
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Reut_A2846
Messenger RNA biogenesis [BR:reu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Reut_A2846
Transfer RNA biogenesis [BR:reu03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    Reut_A2846
 Prokaryotic Type
    Reut_A2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3118442..3118858)
Genome map
AA seq 138 aa AA seqDB search
MIQQRQPLPVRGRRLLAQALSGMVLALAFMQPSLARQQQAEGLAGTIAVQQLPNEARQTL
ERIEAGGPFPYEKDGTRFGNYERALPQQQRGYYREYTVKSQNSRNRGAKRIVCGGDQRAA
NDCYYTEDHYNSFKRITK
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgatacagcagcggcaaccgctgcccgtgcgcggccggcgcttgctggcgcaggcgttg
tcaggcatggtcctggcattggccttcatgcagccgtcgctggccaggcagcaacaggcc
gagggactggcgggaaccattgccgtgcagcaactgcccaatgaggcacggcagacgctg
gagcgtatcgaggccggcggcccgtttccctacgagaaggacggcacgcgattcggcaac
tatgaacgcgccctccctcaacaacaacgcggttactaccgcgaatatacggtcaagagc
cagaacagccggaaccggggagcaaagcggatcgtttgcgggggcgaccagcgcgcggcg
aacgactgctactacacagaagaccactacaacagcttcaaacggataaccaaatga

DBGET integrated database retrieval system