KEGG   Ralstonia eutropha JMP134: Reut_A2984Help
Entry
Reut_A2984        CDS       T00268                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:reu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:reu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3274193..3275755)
Genome map
AA seq 520 aa AA seqDB search
MTAKPLLPLEVTAQASDALAWLRTKVPASARLTGDTRRLARGDVFLAYVLGNERLSTDGR
PHIAQAIAAGAGAILYEADGFDWTFGDTVPHLALNSLHQLAGPIAAGWYGNPARGVAVTG
MTGTNGKTSCSQWLARLLQATGTPCATIGTLGTGFPDALQPTGFTTPDAVQLQASLASLH
DAGARAVAMEVSSHGLEQERVAGTHFSVAVLTNLTQDHLDYHGTMAEYEAAKARLFRWDG
LRTAVINRDDGMGRRLLASNGAAIAAPHVIEYGIDGPARASISGARGQWLRASGVRATAT
GTAFHIDGSFGSADVATPMIGAFNVSNLLAVLGAALANGVAWDAALAALRALSPVDGRME
LFGAHAGQDGPLAVVDYAHTPDALEKTLEALRPVAQARNGRLWCVFGCGGDRDPIKRPLM
GGVAERLADEIVLTSDNPRSEDPQDILDAIADGMADRARGRQIEDRAAAILYAIKHAAGA
DVVLVAGKGHEATQEAHGRKRPFSDREHVRLALAARGVSA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaagccgctgctcccgctcgaagtcaccgcacaggccagcgacgcgctggcc
tggctgcgtaccaaggtgccggccagtgcccggctgaccggcgatacgcgccgcctggcg
cgcggcgacgtcttcctggcttacgtgctcggcaacgagcgcctgtccaccgacggccgc
ccgcatatcgcgcaggccattgccgccggcgccggtgcgatcctgtatgaggccgatggc
ttcgactggacgttcggcgacaccgtgccgcatctcgcgctgaacagcctgcaccagctt
gccggcccgattgccgccggctggtacggcaatcccgctcgcggcgtggccgtcaccggc
atgaccggcaccaacggcaagacttcgtgcagccagtggctggcgcggctgctgcaagcc
accggtacgccatgcgcgaccatcggcacgctcggtaccggcttcccggatgcgctgcag
ccgaccggcttcactacgcccgatgccgtgcaactgcaagccagtctggctagcctgcac
gatgccggcgcgcgcgcggtggcaatggaagtgtcgtcccacggtctcgaacaggagcgc
gtggccggtacgcatttctcggtcgcggtgctgaccaacctgacgcaggaccacctcgac
taccacggcaccatggccgagtacgaggccgccaaagcgcgcctgttccgctgggacggc
ctgcgcaccgccgtgatcaatcgcgatgacgggatggggcggcgcctgctggcgtccaac
ggcgcggccatcgcggcgccgcatgtgatcgagtacggcatcgacggtccggcgcgtgcg
tccatcagcggcgcgcgtggccaatggctgcgcgccagcggcgtgcgcgcgacggcgacc
ggcaccgcattccacatcgacggcagcttcggcagcgccgatgtcgccacgccgatgatc
ggcgcgttcaatgtcagcaacctgcttgcagtgctcggtgcggcgctggccaacggggtg
gcgtgggatgcggcgctcgccgcgctgcgcgcgctctcgcccgtcgatggccgcatggag
ctgttcggcgcgcacgcgggccaggacggcccgctggccgtggtcgactacgcgcacacg
cccgatgcactggaaaagacgctggaagcgctgcgcccggttgcgcaggcacgcaatggc
cgcctgtggtgcgtgttcggctgtggcggcgaccgcgacccgatcaagcgccccctcatg
ggcggcgtggcggagcgcctggccgacgagatcgtgctgaccagcgacaacccgcgcagc
gaggatccgcaggacatcctcgacgccattgccgacggcatggccgaccgcgcgcgcggt
cgccagatcgaagaccgcgccgctgcgatcctctatgcaatcaagcacgcggccggtgcc
gacgtggtgctggtggccggcaagggccacgaggccacgcaggaagcccatggccgcaag
cggccgttctcggaccgcgagcatgtacgcctggccctcgccgcgcggggggtatcggca
tga

DBGET integrated database retrieval system