KEGG   Ralstonia eutropha JMP134: Reut_A3026Help
Entry
Reut_A3026        CDS       T00268                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01130  Biosynthesis of antibiotics
reu01230  Biosynthesis of amino acids
Module
reu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Reut_A3026
Enzymes [BR:reu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Reut_A3026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAZ62386
UniProt: Q46WU7
Position
1:3328388..3329191
Genome map
AA seq 267 aa AA seqDB search
MSDILDKILAVKADEVSAARKKRDLPSLRAEAESLRNEAGFAPRGFERSLRDKIAAGHAG
VIAEVKKASPSKGVLRENFVPEAIAESYASHGAACLSVLTDVNFFQGHADYLKRARGACP
LPALRKDFMVDLYQVYEARSWGADCILLIVAALDPGLMADLEACAHELGMDVLVEVHGAD
ELDSALRLKTPLLGVNNRNLRTFEVSLDNTLDLLPSMPADRLVVTESGILGPNDVKRMRD
ADVHAFLVGEAFMRAKDPGVELARLFA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctcgacaagatcctggccgtcaaggccgacgaagtctccgccgcgcgc
aagaagcgcgacctgccgagcctgcgcgccgaggccgagagcctgcgcaatgaagcgggc
ttcgcaccgcgcggcttcgaacgttcgctgcgcgacaagattgccgccggccacgccggc
gtgatcgccgaagtcaagaaggcatcgccgtccaagggcgtgctgcgcgagaacttcgtg
cccgaggccatcgccgaaagctacgcgagccacggtgcggcctgcctgtcggtgctgacc
gacgtgaatttcttccagggccacgccgactacctgaagcgcgcgcgtggcgcctgcccg
ctgcccgcgctgcgcaaggacttcatggtcgacctgtaccaggtctatgaagcgcgcagc
tggggcgcggactgcatcctgctgatcgtcgccgcgctcgaccctggcctgatggccgac
ctggaagcgtgcgcgcacgagctgggcatggacgtgctcgtggaagtccacggcgccgac
gaactcgacagcgcactgcgcttgaagacgccgctgctgggcgtcaacaaccgcaacctg
cgcacgttcgaagtctcgctcgacaacacgctggacctgctgccgagcatgccggccgac
cggctcgtggtgacggaatccggcatcctgggcccgaacgacgtgaaacgcatgcgcgat
gccgatgtgcacgcgttcctggtcggcgaagcgttcatgcgcgcgaaggaccccggcgtg
gaactggcgcggttgttcgcgtaa

DBGET integrated database retrieval system