KEGG   Ralstonia eutropha JMP134: Reut_A3035Help
Entry
Reut_A3035        CDS       T00268                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
reu  Ralstonia eutropha JMP134
Brite
Enzymes [BR:reu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Reut_A3035
Secretion system [BR:reu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Reut_A3035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3339641..3340390)
Genome map
AA seq 249 aa AA seqDB search
MFQLMRRHPAWTTAIAGGLAAAGFALHAMAAGEPGTDRIKESLQKMLGGRAEVKSVTKSP
VPGLFEVNVGGQVVYTDATGRYVINGEMIDTKTGTNLTEERLADINRIKWSDLPLARAIK
WTKGDGSRQVAVFSDPNCGYCKRIEQTFQQMDNITVYTFLYPVLSPDSETKAKQVWCSAD
RTKAWRDWMLNKVALTGNGNCKTPLDDNLALGQRMNITGTPAVFFMDGTRIPGAADAGTL
ERKLASIKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgttccaactcatgcgccgccaccctgcctggaccactgccattgccggcggtctggcg
gccgcaggctttgccctgcacgccatggcggcgggcgaaccgggcacggaccgcatcaag
gaatccctgcagaagatgctgggcggccgcgccgaagtgaagagcgtgaccaagagcccg
gtgccgggcctgttcgaggtcaatgtcggcgggcaggtggtctacaccgatgccaccggc
cgctacgtgatcaacggcgagatgatcgataccaagaccggcaccaacctgacggaagag
cgcctggccgacatcaaccgcatcaagtggtccgacctgccgctcgcgcgcgccatcaaa
tggaccaagggagacggcagccgccaggtcgccgtgttctccgatccgaactgcggctac
tgcaagcgcatcgagcagaccttccagcagatggacaacatcacggtctacaccttcctg
tatccggtgctgtcgcccgattcggaaaccaaggcgaagcaggtctggtgctccgccgac
cgcaccaaggcgtggcgcgactggatgctgaacaaggtcgcgctgaccggcaacggcaac
tgcaagacgccgctcgacgacaacctcgcactcggccagcgcatgaacatcacgggcacg
cccgcggtgttcttcatggacggcacgcgcattccgggcgcggccgacgccggcacgctc
gaacgcaagctcgccagcatcaagaagtaa

DBGET integrated database retrieval system