KEGG   Ralstonia eutropha JMP134: Reut_A3111Help
Entry
Reut_A3111        CDS       T00268                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:reu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:reu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3418292..3419629)
Genome map
AA seq 445 aa AA seqDB search
MNATEMENVSIRRLDSSDPRFAQALREVLAFEAGEDEAIDRAVAQILADVKDRGDAAVLE
YTQRFDRVEAASMGALEISQSELEAALEDLEPKRRAALEAAAARVRAYHEKQKIECGSHS
WEYTEADGTMLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPARVAGVKEIIMVVPTPGG
VRNELVLAAAQIAGVDRVFTIGGAQAVGALAYGTATLPQVDKIVGPGNAYVAAAKRRVFG
TVGIDMIAGPSEILVICDGTTDPDWVAMDLFSQAEHDELAQSILLCPDADYIAQVEASIQ
RQLDSMPRREVIAASISGRGALIKVRDMEEACEIANAIAPEHLEISAENPRQWSEKIRHA
GAIFLGRYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIEVSEGGAQMLGQ
IAAELAYGEGLQAHARSAEYRFKRS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaccgaaatggaaaacgtgtcgatccgccggctcgattcaagcgatccgcgc
ttcgcgcaagcgctgcgcgaggtgctggccttcgaggccggcgaggacgaggccatcgac
cgcgccgtggcgcagatcctggccgacgtgaaggatcgcggcgacgccgcggtactcgaa
tacacgcagcggtttgaccgggtcgaggcggcgtcgatgggcgcgctggaaatctcgcaa
agcgaactcgaagctgcgctcgaagacctggagccgaagcgccgcgccgcgctggaagcc
gccgccgcgcgcgtgcgtgcctaccacgagaagcagaagatcgaatgcggcagtcatagc
tgggaatacaccgaggccgatggcaccatgctgggccagaaggtgacgccgctggaccgc
gtcggcatctacgtgccgggcggcaaggccgcgtacccgtcgtcggtgctgatgaatgcg
attcccgcgcgcgtcgcgggcgtcaaggaaatcatcatggtcgtgcccacgccgggcggc
gtgcgcaatgaactggtgctggcggctgcgcagatcgctggtgtcgaccgcgtgttcacc
atcggcggcgcgcaggcggttggcgcgctggcctacggtacggcgacgctgccgcaggtc
gacaagatcgtcggccccggcaacgcctatgtggccgcagccaagcgccgcgtgttcggc
accgtgggcatcgacatgatcgccggcccgtcggagatcctggtgatctgcgacggtacg
actgatccggactgggtggcgatggacctgttctcgcaggccgagcacgatgaactcgcg
cagtcgatcctgctgtgcccggacgccgactacatcgcgcaggtcgaggcaagtatccag
cgccagctcgacagcatgccacgccgcgaggtgatcgccgcatcgatttcaggccgtggc
gcgctgatcaaggtgcgcgacatggaagaagcttgcgagatcgccaacgcgatcgcgccc
gagcacctcgagatctcggccgagaacccgcgccagtggagcgagaagatccgccacgcc
ggcgccattttcctgggtcgctataccagcgagtcgctcggcgactactgcgcggggccg
aaccacgtgctgccgacttcgcgcaccgctcgcttctcgtcgccgctgggcgtgtacgac
ttccagaagcgttcaagcctgatcgaggtcagcgagggcggggcgcagatgctgggccag
atcgcggccgaacttgcatatggcgaaggcctgcaggcccacgcgcgcagcgccgagtac
cgtttcaagcgtagttga

DBGET integrated database retrieval system