KEGG   Ralstonia eutropha JMP134: Reut_B3480Help
Entry
Reut_B3480        CDS       T00268                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
reu  Ralstonia eutropha JMP134
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Reut_B3480
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Reut_B3480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:16819..17283
Genome map
AA seq 154 aa AA seqDB search
MRACPSGPSGPSGPHSDVRLMHHAVPRRLAALTCLAVAFAASAASAASSASAADIQAGKA
LFATRCASCHSVGPSARGAFGPQLNAVFGRRAGSTSDYRYSPAMTASGVVWTADTLRAFI
KSPGKVVPGTRMRFWGIGNDQQIDDLLAYLQTYR
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcctgtccatccgggccatccggcccatccggaccccactccgacgtacgactc
atgcatcacgctgtaccgcgccggctggcggccctgacttgccttgccgtggcttttgcc
gcttccgccgcttccgccgcttcttccgcttccgccgccgacatccaggccggcaaggcg
ctgtttgctacccgttgcgcgtcgtgccacagcgtgggcccgtccgcacgcggcgccttc
ggcccgcagctcaacgccgtcttcggccggcgcgcgggcagcacttccgactatcgctat
tcgcccgccatgaccgcgtccggcgtggtgtggacggccgacacgctgcgcgcgttcatc
aaatcgccgggcaaggtcgtgccaggtacgcgcatgcgcttctggggcatcggcaacgac
cagcagatcgacgacctgctggcctacctgcagacttaccggtaa

DBGET integrated database retrieval system