KEGG   Ralstonia eutropha JMP134: Reut_B3526Help
Entry
Reut_B3526        CDS       T00268                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:reu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(70634..71812)
Genome map
AA seq 392 aa AA seqDB search
MWRALPGLTRWLAAGALACACVAALPAHAATCGWADWDTFKRTLISADGRVIDASTDDKV
TVSEGQAYGLFFALVANDRTTFDKLLAWTENNLAQGDLIAHLPAWIWGRIPADKAKDGKE
TWGVIDTNSASDADLWIAYTLLEAGRLWNERRFTALGTLTARRIMREETAAMRGLGRTVL
PGPVGFSLSEGRWRVNPSYVPLQVMRRLAVLLAKESGWDQLVASSLKVILETAPRGFSPD
WAEYDNSRGFLPDTATKAESAYNAIRVYLWAGTLAADDPQRARMLQQFMPLADYVAAHGY
APERVDTQTGQPGPDSGNAGFSAAVAPYLAALGRTDQARAQAQRTRELTAREPLGYYSQA
LALFGLGHLDGLYRFAGDGALLPAWKTGCPAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgccttgccgggtctgaccaggtggctcgcggccggcgcgctcgcgtgtgcc
tgcgtcgccgcgttgcccgcgcatgccgccacatgcggctgggccgactgggacaccttc
aaacgcacgctgatcagcgccgacgggcgcgtcatcgacgcgagcacagacgacaaggtc
accgtgtctgaagggcaggcctatggcctgttcttcgcgcttgtggcgaacgaccgcacc
acgttcgacaagctcctcgcgtggaccgagaacaaccttgcgcagggcgatctcatcgcc
catctgcccgcctggatctggggccgtattcccgccgacaaggccaaggacggcaaggag
acgtggggcgtgatcgacaccaactccgcttccgacgccgacctgtggatcgcctacacg
ctgctggaagcgggccgcctgtggaacgagcggcgcttcaccgcgctcggcacgctgacg
gcgcgccgcatcatgcgcgaagagactgcggccatgcgcggcctgggccgcaccgtgctg
cctggcccggtcggcttttcgctgagtgaaggccgctggcgcgtaaatccgagctatgtg
ccgctgcaggtcatgcggcgccttgctgtgttgctggcaaaagagtctggctgggaccag
cttgtggccagctcgttgaaggtcatcctggaaaccgcgccgcgcggcttctcgccggac
tgggccgagtacgacaacagccgcggctttctgcccgataccgcaaccaaggccgaaagc
gcctacaacgcgatccgcgtctatctgtgggcgggcacgcttgccgccgacgatccgcag
cgagcccgcatgctgcagcagttcatgccgctggcagactacgtcgcagcccacggatat
gcgcctgaacgcgtcgacacgcagaccggtcagccaggccccgattccggcaatgccggt
ttctcggcggcggtcgcgccctacctggccgcgctcggccgcaccgaccaggcgcgcgcg
caggcgcagcgcacgcgcgaactgactgcacgcgagccgctcggctactacagccaggcg
cttgcgctgttcggcctcggccacctggacggcctgtaccgctttgcaggggacggcgcc
ctgctgccagcctggaagaccggatgtcccgcgcgctga

DBGET integrated database retrieval system