KEGG   Ralstonia eutropha JMP134: Reut_B3582Help
Entry
Reut_B3582        CDS       T00268                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:reu00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(139541..140557)
Genome map
AA seq 338 aa AA seqDB search
MKKISDRIASFSRLQLVGAVTPLEKLDRLSRMLGRDVYIKRDDTTPLAFGGNKLRKLEFL
AADALSKGADTLVTAGAIQSNHVRQTAAVAARLGLRCHALLENPINTTDVDYLRSGNRLL
LDLFDAHGEPVATLDNADAQLQALAERLRGDGYQPYIIPIGGSNPLGALGYVHAGLEMAQ
QADAMGVSFAAVVLASGSAGTHGGLALALAHAMPDAQVVGITVSRPVEAQAPKVAGLIDG
TAELLDIEVPAELRLELWDEYFLPRYGEPNRAALDAIRLLARTEGVLLDPVYTGKAMAGL
LDGVMRKRFAGEGPLLFLHTGGAPALFAYRDALPAVLI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatctcggatcgcattgcttcattttcccgccttcaactggtcggcgcggtc
acccccctggagaaactcgatcgcttgtctcgtatgctcggtcgcgatgtctacatcaag
cgcgatgacaccacgccactcgcctttggcggaaacaagctgcgcaagctcgagtttctg
gcggccgacgccttgagcaaaggtgctgatacgctggtgacagccggcgcgattcagtcg
aatcatgtccggcaaacggccgccgtggcagcccgtcttggactgcgttgccacgcgttg
ctggagaacccaatcaacaccacggacgtcgactatctgcgcagcggtaatcgcctgctg
ctcgacctgttcgacgcgcacggtgaaccggttgccacgctcgacaatgccgacgcccag
ttgcaagcactggccgaacgactgcgcggcgacgggtatcagccctacatcatcccaatc
ggcgggtccaatccgcttggcgcattgggatatgtccatgccggcctggagatggcgcag
caagccgacgcgatgggcgtttcatttgcggctgtcgtgctggcatccggcagtgcggga
acccacggaggcctggcgttggcactcgcccatgcaatgccggacgcacaagtcgtcggt
attaccgtgtcccggcccgtcgaggcgcaggcgcccaaggtggcagggctgatcgacgga
acggcggaattgctcgacatcgaagtaccggcggaactgcggctcgaactgtgggacgaa
tatttcctgccccgctatggcgaacctaaccgggctgcgctcgatgccatcagattgctg
gcccgtacggagggagtcctcctcgaccccgtgtatacgggaaaagcgatggctggcctg
ctcgacggcgtgatgcgcaagcgctttgcgggtgagggtccgctgctgttcctgcatacc
ggcggcgcaccggcgctatttgcctatcgcgacgcgctcccggcagtcctcatttaa

DBGET integrated database retrieval system