KEGG   Ralstonia eutropha JMP134: Reut_B4054Help
Entry
Reut_B4054        CDS       T00268                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Reut_B4054
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Reut_B4054
Enzymes [BR:reu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Reut_B4054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:693950..694864
Genome map
AA seq 304 aa AA seqDB search
MKPITLFGAPTDVGASTRGCTMGPEALRIADIVPALARMGLDVSDAGNIAGPVNPLAPPV
QGLRHLDEVVAWNRGVFEASTRILQAGRMPVLLGGDHCLAVGSVSAVARHCREAGRKLVV
LWLDAHADANIGTSTPTGNMHGMPVACLCGDGPTPLTTLGGQPPAVRPEEIRQVGIRSVD
AQEKLRLHALGLKVFDMRYIDEYGMRQTMEQALAGVDDDTHLHVSFDVDFIDSAIAPGVG
TTVLGGPTYRETQLCMEMIADTGRLSSLDVMELNPACDVRNETARLVVDFLESLFGKSTL
LRAR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgattaccctgtttggcgcgccgacggatgtcggcgcaagcaccagaggctgc
acgatgggccccgaagcgctgcgcattgccgacatcgtcccggcgcttgcgcggatgggg
ctcgatgtcagcgacgccggcaatattgctggtccggtgaatccgctcgcgccgccggta
cagggcctgcgccatctcgatgaggtggtggcgtggaatcgcggcgtgttcgaggccagt
acgcgcattctccaggcgggccggatgccggtcctgcttggcggtgaccactgcctggcg
gtcggatcggtcagtgcagtcgcccgtcattgccgggaggcaggccggaagctcgtcgta
ctctggctcgatgcccatgccgatgccaatatcgggaccagtacgccgaccggcaatatg
catggcatgccagtggcctgcctgtgcggcgacggccccacgccactgaccacgctcggc
ggccagccgccggcggtacgtcccgaggaaatccggcaagttggcatccgcagcgtcgat
gcgcaggaaaagctgcggctgcatgcgctgggcctcaaggtgttcgatatgcgctatatc
gacgagtacggcatgcgccagaccatggagcaggcgctcgccggcgttgatgacgacacg
cacctgcacgtgagcttcgacgtcgatttcatcgattcggccatcgcgcccggcgtcggt
acgacggtgctgggcggacccacgtatcgcgagacacaactctgcatggaaatgatcgct
gatacgggacgattgtcttcgctggacgtaatggagctcaaccctgcctgcgatgtgcgt
aatgagacagcacggctggtggtcgatttcctggaaagcctgtttggcaagtccacgcta
ctgcgggcgcgctga

DBGET integrated database retrieval system