KEGG   Ralstonia eutropha JMP134: Reut_B4229Help
Entry
Reut_B4229        CDS       T00268                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Reut_B4229
Enzymes [BR:reu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Reut_B4229
Exosome [BR:reu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Reut_B4229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:871967..874219
Genome map
AA seq 750 aa AA seqDB search
MNRVDTRPPERRTQTISDGELGALVEGRHRDPFAILGPHRDGDTLIVRACVPGAHSVMLA
DSRGEPLAPMTPLHAGGVFTGRLPAGVSVYQLLVRWHNGTQQVSHDPYAFGLLLGELDLH
LIAEGRHFELGACLGAQWRNVDGVQGVRFAVWAPNARRVSVIGDFNGWQPARHPMRLRHP
SGVWELFIPEAMGARPGCRYKFDLLDPHDAQLPDKADPLALATEAPPATASVVTQPQVSA
PPFAWQDDEWMRLRNAVDPYAAPLSIYEVHVGSWLRAANDPARGWEVLADRLIPYVHELG
FTHIELLPVTEHPFGGSWGYQPLSLYAPTARLGPPQAFAAFIDRCHRDGIGVILDWVPAH
FPTDPHGLARFDGTALYEHEDPREGFHQDWNTLIYNLGRNEVRGFLLAGALHWLEHFHVD
GLRVDAVASMLYRDYSRAPDQWVPNRFGGRENLEAVAFLRELNTVVHERCPGALTIAEES
TAWPGVTASAASGGLGFDFKWNMGWMHDTLRYLSLDPIHRAWHHQDMTFGTVYAWSEAFV
LPLSHDEVVHGKGSMLRKCPGDDWQRFAGLRAYYGFMWAHPGKKLLFMGGELAQWQEWNH
DAELDWALLDHPMHRGVHTLVRDLNALYRELPALHELDHSPAGFQWVVGDDHQNSVFAWL
RRPAPGSGDVVLAVTNMTPVPRYGYRIGVPSEGCWHERLNTDAACYGGSNLGNGGAVTAE
PVPSHGQEASVLLTLPPLATVILQHAGTQA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgagtcgacacccggccgcccgagcgacggacgcaaaccatatccgacggcgag
ttgggcgcgctggttgaaggtcggcatcgcgatccgtttgcgattctgggcccgcatcgc
gacggcgatacgctgatcgtgcgcgcctgcgtgcccggggcgcactccgtgatgctggcc
gattcgcggggtgaaccgctggcccccatgacgccgctgcacgcgggcggcgtgttcacc
ggccgcctgcccgccggggtctccgtctaccagctcctggtccgctggcacaacggcact
cagcaggtgagccacgatccttatgcgttcggactgctgctgggcgagctggacctgcac
ctcattgccgaaggccggcacttcgagcttggggcctgtcttggcgcacagtggcgcaac
gtggacggcgtccagggtgtgcgctttgcggtgtgggcgcccaacgcccggcgcgtgtcg
gtcatcggcgatttcaacggctggcagcccgcgcggcatcccatgcggctgcgccacccg
agcggcgtctgggaactcttcattcccgaagccatgggcgcgcggcccggctgccgctac
aagttcgacttgctggacccgcatgacgcgcaattgcccgacaaggccgacccgctcgcg
ctggcgaccgaggcgccgccagcaacggcatcggtcgtgacgcagccgcaggtttccgcg
cctccgttcgcgtggcaggacgatgagtggatgcgcctgcgcaatgccgtcgatccgtat
gcggcgccgctgtcgatctacgaggtccacgtcggctcctggctgcgcgcggccaacgac
ccggcacgcggctgggaggtgctggccgaccggctcatcccctatgtccacgaactgggc
ttcacgcacatcgaactgctgcccgtgacggagcacccgttcggcggctcgtggggctac
cagccgctgtcgctctacgcgcccacggcgcgactgggacccccgcaggcgttcgcggcc
tttatcgatcgctgtcaccgcgacggcatcggcgtcatcctcgattgggtacccgcgcat
ttcccgacggatccacacgggctggcgcgcttcgatggcaccgcgctctacgagcacgaa
gacccgcgcgaaggcttccaccaggactggaatacgctgatctacaaccttgggcgcaac
gaagtgcgcggcttcctgctggcgggcgcgctgcactggctcgaacacttccacgtcgac
ggcctgcgcgtcgatgcggtggcctccatgctctaccgcgactacagccgcgcccccgac
caatgggtgcctaaccgcttcggcggacgcgagaacctggaggcagtcgccttcctgcgc
gaactcaacaccgtcgtgcatgaacgctgccccggcgcgctcaccattgccgaggaatcc
acagcgtggcctggcgtgacagccagcgcggccagcggcgggctcggcttcgacttcaag
tggaatatgggctggatgcacgacacgctgcgctacctgtcgctggatccgattcaccgc
gcgtggcaccaccaggacatgacgttcggcaccgtctacgcgtggtcggaagcgttcgtg
ctgccgctgtcgcacgacgaagtcgtgcacggcaaaggctcgatgctgcgcaagtgcccg
ggcgacgactggcagcgcttcgccggactgcgcgcctactacggcttcatgtgggcccat
ccgggcaagaagctgctgttcatgggcggtgaactggcccagtggcaggaatggaaccac
gacgccgagctcgactgggcactgctcgaccatccgatgcaccgcggcgtccacacgctg
gtgcgcgacctcaatgcgctctaccgggagttgcctgccttgcatgaactcgaccattcg
cccgccggcttccagtgggtagtcggcgacgatcaccagaacagtgtattcgcgtggctg
cgccgtccggcgcccggcagcggagacgtcgtgctggccgtcacgaatatgacgccagtg
ccgcggtacggctaccggatcggcgtgccgtccgaaggctgctggcatgagcggctcaac
accgacgcggcgtgttacggcggcagcaacctgggcaatggcggtgccgtgaccgccgag
ccggtgccatcgcatggacaggaggcctccgtcttgctgacgctgccgccgctggccacg
gtgatcctgcagcacgccggaacgcaggcatga

DBGET integrated database retrieval system