KEGG   Ralstonia eutropha JMP134: Reut_B4231Help
Entry
Reut_B4231        CDS       T00268                                 

Definition
glycoside hydrolase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Reut_B4231
Enzymes [BR:reu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Reut_B4231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:876444..878645
Genome map
AA seq 733 aa AA seqDB search
MSPKTPSDTDALHALAVHVGVQPRWLDAWGRPQQVPDDALRRILQGLALSCDTPAQCRAS
GARLDAEDAALGLPPLITADPGEPIDIPWPNGAEARPYRIQLEDGSHLDGTAQPAGNGTL
RLSPVAVCGYHCLHIGEAETVLAVAPPRCFGVEDALREAGRRTAGERAWGLAVQLYALRR
GAPTGMGDLTALAQCCEAAARQHADAVAINPLHAGFAALPDRYSPYSPSSRLFHNPLYAD
PAAAFGQEAVDSAMAALNVGTAFAQHESRSEIDWANISRLRLSVLRWLWQHRAHLLPQAS
LDACAAFRARGGTALHDHACYEAIQASRLGEAANPMNANGSADWRCWPVTLRSPTDAAVT
AFAVAHPQEIEYHIFLQWLADDGLARAQRAARDAGMAIGVIGDLAVGADPGGSQAWSRQQ
DILPGFHAGAPPDVYNPHGQDWGVTVFSPRRLRQRGYGAFIEMLRANLAHAGGLRIDHVL
GLARMWLVPAGASARDGAYLAFPLQELLRLVALESWRHHAIIIGENLGTVPAHLDSALAG
RGVLGIDVLWFERETLKPDDNDSPASAATDTPPFLPAEAWPRHAVATTSTHDLPTVAGWW
QGRDLTWREQLGLLAQDETPEGVHAARVRERTALWQALCDAGLASGTAPDPEHPPLDAVL
AWLGRTRTPLRLLPVEDLLGVSEQANLPGTTAGHPNWQRRLDADVRRLFDAPAMRTRAQS
VRHGRVPGPPRQR
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgagccccaagaccccctccgatacagacgcattgcatgcgctcgccgtgcacgtcggc
gtacagccacgctggctcgatgcctggggccggccgcaacaggttccggacgacgcactg
cggcgcatactgcagggcctggcgctgtcctgcgacacgcccgcgcaatgccgggcctcc
ggcgcacgcctcgatgcggaagacgccgcgctgggactgcccccgctgatcacggcggac
ccgggtgagcccattgatattccctggcccaatggcgccgaagccaggccgtaccggatc
caactcgaggacggcagccacctcgacggcaccgcgcagcctgccgggaacgggacgctg
cgcctgtcgcccgtggccgtgtgtggctaccactgcctgcacatcggcgaggcggagacc
gtcctggccgtcgccccgccgcgctgcttcggcgtggaggacgcactgcgcgaagccggc
cgccgcacagcgggcgaacgcgcatggggcctggccgtgcagctctatgcgctgcgtcgc
ggcgcaccgactggcatgggcgacctgaccgcgctcgcacagtgctgcgaggccgctgcc
cgccagcacgcggatgcggtggcaatcaacccgctccatgctggctttgccgcgctgccg
gatcgctacagcccttactcgccgtccagccggctgttccacaacccgctctacgccgac
ccggcggcggcattcggccaggaagcggtcgatagcgcgatggcggcgcttaacgtcggc
acggcattcgcgcagcatgagtcgcgcagcgagatcgattgggcgaacatctcgcgcctg
cgcctttcggtgttgcgctggctatggcagcaccgtgcgcacctcttgccgcaagcgtcg
ctggatgcgtgcgccgcgttccgtgcacgcggcggcacggcgctgcacgaccacgcgtgc
tatgaggcgatccaggcgagccgcctcggcgaggcagccaaccccatgaacgccaacggc
tccgcggactggcgttgctggcccgtcacgctgcggtccccgaccgatgcagccgtgacc
gcgttcgcagtcgcgcatccgcaggagatcgagtaccacatcttcctgcaatggctcgcg
gacgacggcctggcgcgggcgcagcgcgcggcgcgggacgctggcatggccattggcgtg
atcggcgacctcgcagtcggcgccgatcccggcggcagccaggcgtggtcgcgccagcag
gacatactgccgggcttccacgcgggcgcgccgcccgatgtttataacccgcacgggcag
gactggggcgtcaccgtattttcgccgcgaaggctgcgccagcgcggctacggggcgttc
atcgagatgctgcgtgccaacctggcgcatgcgggcggcttgcgcatcgaccacgtgctg
gggctggcgcgcatgtggctggtgcccgctggcgcctccgcgcgcgacggcgcctatctc
gccttcccgctgcaggagttgttgcggctggtggcgctggaatcgtggcggcaccacgca
atcatcatcggcgaaaaccttggcacggtgccggcgcatctggacagcgcactcgccggg
cgcggcgtgctgggcatcgacgtgctgtggtttgagcgcgaaacactgaaaccggacgac
aacgacagcccggcgtctgcagccacggacacgccgccgttcctgcccgccgaagcgtgg
ccgcggcacgccgtggccaccacgtctacgcacgacttgcccacggtcgcgggctggtgg
caaggccgggacctgacatggcgcgagcagttgggcctgctggcgcaggacgaaacgccg
gaaggcgtacacgccgcccgtgtgcgcgagcgcacggcgctgtggcaggcgctgtgcgat
gctggcctggccagcgggacggcgcccgatccggagcatccgccactggacgccgtgctg
gcctggctgggccgcacgcgcacgccgctgcgcctgctgccggtggaagacctgcttggc
gtgtccgagcaggcgaacctgcccgggaccacggcaggccaccccaactggcagcgcagg
cttgacgcggacgtacgccggctctttgacgccccggcaatgcgcacccgggcacagagc
gtgcgtcacggccgggttcccggcccgccgcgccagcgctga

DBGET integrated database retrieval system