KEGG   Ralstonia eutropha JMP134: Reut_B4391Help
Entry
Reut_B4391        CDS       T00268                                 

Definition
(RefSeq) NAD-dependent epimerase/dehydratase
  KO
K08678  
UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Reut_B4391
   00520 Amino sugar and nucleotide sugar metabolism
    Reut_B4391
Enzymes [BR:reu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Reut_B4391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1047924..1048976
Genome map
AA seq 350 aa AA seqDB search
MREADRKRVLVTGGAGFLGSHLCERLVELGHDVLCVDNFYTGSKENISHLLPLYNFELLR
HDVTFPLYVEVDQIYNLACPASPVHYQSDPVQTTKTSVHGAINMLGLAKRVKARILQAST
SEVYGDPDNHPQRESYWGHVNPVGRRACYDEGKRCAETLFMDYHRQHGVDVRIARIFNTY
GPRMHPADGRVVSNFISQALDGEPLTLYGDGSQTRSFCFVDDLVDGLMRLMESDAAATPV
NLGNPCECTMHAIANEILQATGSASAIETRPLPEDDPRQRCPDITLARTLLQWNPATTLT
EGLRLTVAYFVSRRAERARRQKAANRAAPLAKSAEASRQAPQPSPAPDVS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaagccgatcgcaagcgcgtcctggtaaccggaggtgccgggtttctgggttcg
cacctgtgcgagcgcctggtcgaactcggccacgatgtactttgtgttgataatttctac
acgggctcgaaggagaacatctcccacctgttgcctctctacaatttcgagctgctgcgc
cacgacgtgacgttcccgctttatgtcgaggtggaccagatctacaacctcgcgtgcccg
gcatcgcccgtccactaccagagcgatccggtgcagaccaccaagaccagcgtgcatggc
gcgatcaacatgctcggactggccaagcgggtgaaagcgcgcatcctgcaggcatccacc
agcgaggtctacggcgacccggacaaccatccgcagcgcgaaagctactggggccatgtc
aaccctgtcgggcggcgcgcctgctacgacgagggcaagcgctgcgccgaaacgctgttc
atggattaccaccgccagcacggcgtcgatgtgcgtattgcacgcattttcaacacctac
gggccgcgcatgcatccggccgacggacgcgtagtgtcgaacttcatttcgcaggcgctg
gatggcgagccgctgacgctctacggtgacgggtcgcagacgcgttcgttctgctttgtc
gatgatctcgtcgacggactgatgcggttgatggagtccgacgccgcggcaacgcccgtg
aatctcggcaacccgtgcgaatgcacgatgcatgcaatcgcgaacgagatcctgcaggcg
accgggtcggcttcggccatcgagacgcgcccgctgccggaggacgatccgcgccagcgc
tgccccgacatcacactggcacgcacgttgctgcagtggaacccggcgacaaccttgacg
gagggcctgcggctgacagtggcgtatttcgtctcgcgtcgggccgaacgcgcgcggcgg
cagaaggccgccaatcgcgccgcgccactggcgaagtccgcggaagcatcgcggcaggcg
ccacagccatcgcccgctcccgacgtctcctga

DBGET integrated database retrieval system