KEGG   Ralstonia eutropha JMP134: Reut_B4391Help
Entry
Reut_B4391        CDS       T00268                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:reu00523]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of vancomycin group antibiotics
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:reu00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1047924..1048976
Genome map
AA seq 350 aa AA seqDB search
MREADRKRVLVTGGAGFLGSHLCERLVELGHDVLCVDNFYTGSKENISHLLPLYNFELLR
HDVTFPLYVEVDQIYNLACPASPVHYQSDPVQTTKTSVHGAINMLGLAKRVKARILQAST
SEVYGDPDNHPQRESYWGHVNPVGRRACYDEGKRCAETLFMDYHRQHGVDVRIARIFNTY
GPRMHPADGRVVSNFISQALDGEPLTLYGDGSQTRSFCFVDDLVDGLMRLMESDAAATPV
NLGNPCECTMHAIANEILQATGSASAIETRPLPEDDPRQRCPDITLARTLLQWNPATTLT
EGLRLTVAYFVSRRAERARRQKAANRAAPLAKSAEASRQAPQPSPAPDVS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaagccgatcgcaagcgcgtcctggtaaccggaggtgccgggtttctgggttcg
cacctgtgcgagcgcctggtcgaactcggccacgatgtactttgtgttgataatttctac
acgggctcgaaggagaacatctcccacctgttgcctctctacaatttcgagctgctgcgc
cacgacgtgacgttcccgctttatgtcgaggtggaccagatctacaacctcgcgtgcccg
gcatcgcccgtccactaccagagcgatccggtgcagaccaccaagaccagcgtgcatggc
gcgatcaacatgctcggactggccaagcgggtgaaagcgcgcatcctgcaggcatccacc
agcgaggtctacggcgacccggacaaccatccgcagcgcgaaagctactggggccatgtc
aaccctgtcgggcggcgcgcctgctacgacgagggcaagcgctgcgccgaaacgctgttc
atggattaccaccgccagcacggcgtcgatgtgcgtattgcacgcattttcaacacctac
gggccgcgcatgcatccggccgacggacgcgtagtgtcgaacttcatttcgcaggcgctg
gatggcgagccgctgacgctctacggtgacgggtcgcagacgcgttcgttctgctttgtc
gatgatctcgtcgacggactgatgcggttgatggagtccgacgccgcggcaacgcccgtg
aatctcggcaacccgtgcgaatgcacgatgcatgcaatcgcgaacgagatcctgcaggcg
accgggtcggcttcggccatcgagacgcgcccgctgccggaggacgatccgcgccagcgc
tgccccgacatcacactggcacgcacgttgctgcagtggaacccggcgacaaccttgacg
gagggcctgcggctgacagtggcgtatttcgtctcgcgtcgggccgaacgcgcgcggcgg
cagaaggccgccaatcgcgccgcgccactggcgaagtccgcggaagcatcgcggcaggcg
ccacagccatcgcccgctcccgacgtctcctga

DBGET integrated database retrieval system