KEGG   Ralstonia eutropha JMP134: Reut_B4661Help
Entry
Reut_B4661        CDS       T00268                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
reu  Ralstonia eutropha JMP134
Brite
Enzymes [BR:reu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Reut_B4661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1352808..1353707)
Genome map
AA seq 299 aa AA seqDB search
MDGQFLGGDATGSCNTVAALLIHGLGGTEHELRLVEKTLKAEGYETKCAVLPGHGTRPED
LVGVRFEQWLEAVSVEYLELRARHDTVHIVGMCMGALLALALSQLIGDRRGRVVALAAPV
FLDGWSLPWYRGLRHLVYRLPRARDKFRVKESEPFGVKNGVLRAAIKARFLRGDTFHYSW
TPLTCIRELDRLRSYVRKRVRRVSRPALIIHAREDELTSLRSAYFLSKHIRAAKLLVVDE
SYHMLSIDNDRRLVASTVAQFLREDENSGQNFGTALRGVFAEPANEPFEALVGISLAAE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggatggacagttcttgggtggcgatgctacgggttcttgcaatacagttgcagcccta
ttgatccacggtctcggcggtaccgaacatgagcttcggcttgtcgagaagacgctgaag
gcggaaggatacgaaacaaagtgcgccgtactgcccgggcatggtacacgcccggaggat
ctggtcggcgtaaggttcgagcagtggcttgaggccgtatcggtcgaatatctcgaactg
cgcgccaggcacgataccgtccacatcgtcggcatgtgcatgggtgcgttgctggcgctt
gcgttgagccagttgatcggcgacaggcgcggccgcgtcgtcgcactggcagcacctgta
ttcctcgacggctggtctctgccctggtatcgcggcttgcggcatctggtgtaccgtctg
ccgcgagcccgcgacaaattccgcgtgaaggaatccgagccgttcggtgtcaagaacggc
gtattgcgcgcggcaatcaaggctcgcttcctgcgaggcgacacgtttcactattcgtgg
acgccgctcacttgcatccgcgaactggatcgcctgcgcagctacgtccgcaagcgcgta
cggcgcgttagccggccagcactgattattcacgctcgcgaagatgagttgacgagcctg
cgatcggcctactttctcagcaagcacattcgcgcggccaagttgctcgtcgtggacgag
agctaccacatgctgagcatcgacaacgatcgcaggctggtcgccagcactgtcgcgcag
tttctccgcgaagacgagaacagtggacagaacttcggcaccgcgctgaggggcgtcttt
gccgaacccgcgaacgagccattcgaggcattggtcggtatctccctggccgccgaatag

DBGET integrated database retrieval system