KEGG   Ralstonia eutropha JMP134: Reut_B4897Help
Entry
Reut_B4897        CDS       T00268                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
reu  Ralstonia eutropha JMP134
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1620855..1621856)
Genome map
AA seq 333 aa AA seqDB search
MTVNDYALVTGASGFLGSAVVRQALARGWRVRALVRATSPRANLDGLPVEVFEGDMRDPA
ALTSAMRGVRYLFHVAADYRLWAPDPEEIVRTNVDGTMAVMEAAQEAGVERVVYTSSVAT
LRVAGASAPVDETAAMTPHEAIGAYKRSKVLAERVVERMVAERGLPAVIVNPSTPIGPRD
VRPTPTGRIIVEAATGKIPAFVETGLNLVHVDDVAAGHFQALERGRIGERYILGGDDVML
QQMLRDIADLCGRRPPTVQLPRWPLYPLAHAAEAVARITRKEPFVTVDGLHMSKYRMFFR
SDKARQELGYQPRPYIDGLRDALDWFREAGYLR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtaaacgattacgcgctggtgacaggtgcatcgggttttctcggatccgcggta
gtgcggcaggcactggcgcgcggctggcgcgtgcgcgcgctggtgcgggcgacgagcccg
cgcgccaatctggatggtctgcccgtcgaggtgttcgagggagatatgcgcgaccccgcc
gcgctgacgtccgccatgcgcggggtgcgctacctgttccatgtggcggccgattatcgg
ctatgggcccctgatcccgaggaaatcgtccgcaccaatgtcgacgggaccatggcggtc
atggaagccgcgcaggaggcaggggtagagcgcgttgtctataccagcagcgtggcgacg
ttgcgggtggcgggtgcctcggcgccggtcgacgagacggccgccatgacaccgcacgag
gccatcggcgcgtacaagcgcagcaaggtgctggccgagcgtgtggtcgagcgcatggtc
gccgagcgcgggttgccggccgtgatcgtcaatccgtccacgccgatcgggccgcgggac
gtccggcctacgccgaccggacgcatcatcgtcgaggccgcgaccggcaagattccggcc
tttgtcgagaccgggctcaaccttgtccatgtcgatgacgtcgccgccgggcatttccag
gcgctggagcgaggccgcatcggcgaacgctacatcctgggcggtgacgacgtgatgctg
cagcagatgctgcgcgatatcgcggatttgtgcggacgccgtccgccaaccgtgcaactg
ccgcgctggccgctgtatccgctggcgcatgccgcggaggcggtggcgcgcatcacgcgc
aaagagccctttgtcaccgtggatgggctccatatgtcgaagtaccggatgtttttccgc
tcggacaaggcccggcaggagcttggctatcagccgcgtccttatattgatggcctgcgc
gacgcgctggactggttccgcgaggccggttacctgcgctga

DBGET integrated database retrieval system