KEGG   Ralstonia eutropha JMP134: Reut_B4978Help
Entry
Reut_B4978        CDS       T00268                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Reut_B4978
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_B4978
   00020 Citrate cycle (TCA cycle)
    Reut_B4978
   00620 Pyruvate metabolism
    Reut_B4978
Enzymes [BR:reu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Reut_B4978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1705155..1706264
Genome map
AA seq 369 aa AA seqDB search
MRVFKLPDLGEGLQEAEIVTWHVKVGDTVAADQPLLSVETAKAIVEIPSPYAGTIGKLFA
QAGDLVHLGAPLASFEGAGNDADAGTVVGAVKVGSHVVAESATPLSGGAAGAGIKATPAV
RALARRLGVDLAMANPSGPDGVVTAADVERVASTLAETGPGEVLRGVRRAMAQNMARAQS
EVAAATVMDDADIHAWQGAHDVTIRLVRALVAGCRAEPGLNGWYEGQTGKRHVMQKIDVG
IAADLPEGLFVPVLRNVGNRDAADLRHGLDRMRADIRARTIAPEEMRGNTITLSNFGMIA
GRYAAPIVVPPTVAILGAGHIRDEVVAANGVPAVHRVIPLSLTFDHRVVTGGEAARFLAA
VIADLALPE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagagtcttcaagctgcccgacctgggcgaaggcctgcaggaagccgagatcgtgacg
tggcatgtgaaggtcggcgacaccgtggccgcggatcagccgttgctgtcggtcgaaacg
gccaaggccattgtggaaatcccctcgccgtatgccggcacgattggcaagctgtttgca
caggcgggcgacctcgtccaccttggcgcgccgctcgcgagcttcgaaggcgcgggcaac
gatgccgatgcgggcaccgtagtaggcgcggtcaaggtcggctcgcatgtggtggcagaa
tccgccacgccgctgagcgggggtgcggccggcgcgggcatcaaggccacgccggcggtg
cgcgcgctggcaaggcggctcggcgtggacctggcgatggcaaacccgtccgggcccgac
ggtgtcgtcacggctgctgatgtggaacgcgtcgcatcaacactggctgaaaccggcccg
ggtgaagtgctgcgcggcgtgcgtcgtgcgatggcgcagaacatggcgcgcgcgcagagc
gaagtcgccgccgcgaccgtgatggacgatgccgatatccatgcgtggcaaggcgcgcat
gacgtgacgatccggctggtgcgcgcactggtggccggttgccgtgcggagccggggctc
aatggctggtacgagggccagaccggcaagcggcacgtgatgcagaagatcgacgtcggc
atcgccgccgacctgcccgaaggcctgttcgttcccgtgctgcgtaatgtgggcaaccgc
gacgccgcggatctgcgacacggcctggaccgcatgcgcgccgatatccgcgcgcgcacg
atcgcgcccgaggaaatgcgcggcaacaccatcacgctgtccaacttcggcatgatcgcg
ggccgctatgccgcgccgatcgtggtgccgcccacggtggcgatcctcggcgccggccat
atccgcgacgaagtcgtcgcggccaatggcgtgccggccgtgcaccgcgtgatcccgctg
agcctgaccttcgaccaccgcgtggtcacgggtggcgaggccgcgcgtttcctggccgcg
gtgatcgccgacctggcgctgcccgaatag

DBGET integrated database retrieval system