KEGG   Ralstonia eutropha JMP134: Reut_B5373Help
Entry
Reut_B5373        CDS       T00268                                 

Definition
(RefSeq) asparagine synthase (EC:6.3.5.4)
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Reut_B5373
Enzymes [BR:reu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Reut_B5373
Peptidases [BR:reu01002]
 Cysteine Peptidases
  Family C44
   Reut_B5373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2153546..2155576)
Genome map
AA seq 676 aa AA seqDB search
MCGFAGFLGGIPGSLEDRAILLTRMGQRILHRGPDHGDLWCEPGAPFGFTHRRLAIVDLS
PAGRQPMISASGRYVIVFNGEIYNHPEIRAELESAGAAPRWRGHSDTETLLAGIDAWGAD
ATVRRTIGMFAFAVWDRQTHSLTLARDRLGEKPLYYGWQGSGQARAFLFGSELKALRPHP
AFDGSIDRNALTLYMRYNNVGGGHSIYQGIAKLPPAHLLTVSMLAREPVLRAYWSGSAAA
LQGKQDPFTGGPQEAVDSLDALLRDAVARQMMADVPLGAFLSGGIDSSTVVALMQSQSTQ
PIRTFSIGFHDAGYNEAAHAKAVARHLGTSHTELYVSPEHAMAVIPRLPEIYDEPFSDSS
QIPTLLVSGLARQHVTVSLSGDAGDELFGGYNRYQITAELWGRLARIPGPVRAAAAWGLT
RLSPHQINRVAALLPMASRWSHVGEKVHKGAGVMAAHTVDELYRGMVSQWQCPDAIVMGG
AEPATLPEPVARALAMLGDVERMMAADLLTYLPDDILTKVDRAAMARSLETRIPFLDHRV
VEFAWRLPLAYKIRQEDAGHTTKWVLRRVLDRYVPRELIERPKMGFGVPIDAWLRGPLRD
WADDLLSEERLRREGFLNPQPIRQRWTEHLSGRRNWQHPLWCVLMFQAWLGHETTERTAP
PLTDIPTSDRRLACAF
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgcaggatttcttggcggtataccgggttccctggaagatcgtgcgatc
ttgctgacccgtatgggacagcggatccttcaccggggtccggaccatggcgacctttgg
tgcgagcccggcgcgcctttcggctttacgcaccggcgcctcgcaattgtcgatctgtcc
ccggccggtcgacagccgatgatttcggcgagcggccgctacgtcattgtgttcaatggc
gaaatttacaaccatcccgaaatacgcgccgaactcgaaagcgcaggggccgcgccgcgt
tggcgagggcactccgacaccgaaacgctgcttgccggcatcgacgcatggggagccgat
gccacggttcggcgaaccatcgggatgtttgcctttgccgtgtgggaccggcaaacgcat
tccctgacgctggcgcgtgaccggctgggcgagaagccgctctactatggctggcagggc
tcaggccaggcgcgtgcctttctattcggatcagagctcaaggcactgcgccctcacccg
gcattcgacggcagcatcgaccgcaacgccctcaccttgtacatgcgctacaacaatgtc
ggtggcgggcattcgatctaccaaggcatcgccaagcttccacctgcgcacttgctgacc
gtgtcgatgctggcgcgcgagcctgttttgcgtgcctactggtcggggtccgcggcagcg
ctgcaaggtaagcaggaccctttcacgggcggtccccaagaagccgtcgacagcctcgat
gcgctgttgcgagatgctgtcgcccgccagatgatggctgacgtgccgctgggcgcattt
ctctccggtggtatcgattcgtcgaccgtggtcgcactgatgcagtcccagtccacacag
ccgatccgcacgttctcgatcggcttccacgacgccggctacaacgaggccgcacacgcc
aaggccgtcgcccgccacctcggcaccagccacaccgagctgtatgtgtcccccgagcat
gccatggcggtgattccgcgattgccggagatctacgacgagccattctccgactcttcg
caaatccccacgctgcttgttagcggactggccaggcagcacgtgacggtgtccctctcc
ggcgacgcgggagacgagttgttcggtggatataaccgctaccagatcacggcagagctt
tggggccggcttgcccgcatccccggtccggtgcgcgccgcggcggcctgggggctgacc
cgtctttctccgcaccagatcaatcgcgtcgcagcgctgctgccaatggcatcgcgctgg
tcccatgtgggggagaaggtccacaagggcgcgggcgtcatggccgcgcacaccgtggat
gaactctatcgcggcatggtctcccagtggcaatgtccggatgcaatcgtcatgggcggg
gcggagccggcaaccttgcctgagcccgttgcaagggcgctggcgatgctcggcgacgtg
gaacgcatgatggcggccgatctgctgacctacctgcccgacgacatcctcacgaaggtc
gaccgcgcggccatggcgcgaagccttgaaactcgcatccccttcctcgatcaccgcgtg
gtggagttcgcctggcggctgccgctggcctacaagatccggcaggaggacgccgggcac
acgaccaaatgggtactcaggcgcgtgcttgaccgctatgtgccacgcgagctgatcgag
cggccgaagatgggatttggcgtcccgatcgacgcatggctgcgtggtccgctgcgcgac
tgggccgacgatcttctgagcgaggagcgcctgcgtcgcgagggcttcctgaatccgcaa
cccatacgccagcgttggactgagcatctgtccgggcggcgcaactggcagcatccccta
tggtgtgtgctcatgttccaggcctggctagggcacgagacaacagagcggaccgcaccg
ccgctgactgatatcccgacatccgataggaggctggcatgcgctttctga

DBGET integrated database retrieval system