KEGG   Ralstonia eutropha JMP134: Reut_B5663Help
Entry
Reut_B5663        CDS       T00268                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00250  Alanine, aspartate and glutamate metabolism
reu00280  Valine, leucine and isoleucine degradation
reu00410  beta-Alanine metabolism
reu00640  Propanoate metabolism
reu00650  Butanoate metabolism
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
Module
reu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Reut_B5663
   00650 Butanoate metabolism
    Reut_B5663
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Reut_B5663
   00280 Valine, leucine and isoleucine degradation
    Reut_B5663
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Reut_B5663
Enzymes [BR:reu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Reut_B5663
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Reut_B5663
Amino acid related enzymes [BR:reu01007]
 Aminotransferase (transaminase)
  Class III
   Reut_B5663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AAZ65008
UniProt: Q46PC6
Position
2:complement(2492293..2493582)
Genome map
AA seq 429 aa AA seqDB search
MALESTHQDLAAARAQHVARGVVTAHPIFVDHAQGSRVWDVNGRSYLDFVGGIGVLNVGH
NHPRVVAAVKQQLERVSHAAFQVAGYDVYIELAARLNRLVGGSEAYKTVFLTTGAEAVEN
AVKIARAYRNAPGIIAFRGGFHGRTLLGMTLTGMSTPYKQNFGPFAGDVYHTPYPDPYRG
FSGDDALRALDDLFATQIAPDRVAAIILELVQGDGGFLAAGSDFLKKLRALTTKHGIVLI
ADEIQTGFGRTGELFAFQEAGIQPDLVTVAKSLAGGLPLSGVVGRAEIMDAPLPGGLGGT
YAGNPLACAAALAVLDLFEDEKLTERARELGTTLRGGLLALADKYQEIGTIRGVGPMLAL
EFVKHGDPHQPDADFAQRVVDACRDEGLLVIKCGVHRNNVRLLAPVNTELDDAHEAIAIL
GRAIAKVRG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcattggaaagcacacatcaggatctggctgcggcgcgcgcgcagcacgtggcccgc
ggcgtagtaaccgcgcatccgatcttcgtggaccacgctcagggctcccgcgtctgggat
gtcaatggccgcagctatctcgatttcgttggcggcatcggcgtgctgaatgtcggccac
aaccacccgcgagtcgtagcggctgtcaagcagcagctcgagcgtgtgagccacgcggcg
ttccaggttgccggctatgacgtctatatcgagctcgctgctcggctgaatcgcctggtg
ggcggttcagaggcctacaagacggtcttcctgaccaccggcgccgaagcggtggagaac
gccgtcaagattgcccgcgcgtatcgcaatgcgccgggcatcattgctttccgcggcggc
tttcacggccgtacgctgctgggcatgaccctgaccggcatgagcacgccgtacaagcag
aacttcggaccgttcgctggcgatgtctatcacacgccgtaccccgacccttatcgcggc
ttcagcggcgacgatgcgctgcgagcgctcgatgacctgtttgcgacacagatcgctccg
gaccgcgtggcggcgatcattctcgaacttgttcagggcgatggcggcttcctggcagcc
ggttcggatttcctgaagaagctgcgcgcgctgaccacgaagcacggcatcgtcctgatt
gccgatgagatccagacgggcttcggtcgcactggagaactttttgcgttccaggaggcg
ggcatacagcccgatctcgtcaccgtggcgaagagcctcgctggtggcctgccgctgtcc
ggcgtcgtgggccgtgccgaaatcatggatgcgccgcttcctggcggcctcggcggcacg
tacgcaggcaacccgctggcctgtgcggctgcactggcggtcctcgacctgttcgaggac
gaaaagctgacggagcgcgcacgcgaactgggcacgaccttgcgcggcggcctcctggct
ctggccgacaagtaccaggagattggtaccattcgcggcgtgggcccgatgctcgcgctg
gagttcgtcaagcacggcgacccgcaccagccggatgcggatttcgctcaacgcgtggtc
gatgcctgccgcgatgaaggtcttctggtgatcaagtgcggcgtacatcgcaacaacgtt
cgtctgcttgctccggtgaacaccgagctcgacgacgcacacgaggccattgccatcctt
ggccgagccatcgccaaggtccgcggataa

DBGET integrated database retrieval system