KEGG   Ralstonia eutropha JMP134: Reut_B5670Help
Entry
Reut_B5670        CDS       T00268                                 

Definition
(GenBank) transcriptional regulator, GntR family
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR
Motif
Other DBs
NCBI-ProteinID: AAZ65015
UniProt: Q46PB9
Position
2:complement(2501533..2502261)
Genome map
AA seq 242 aa AA seqDB search
MTAAKRRSARDSVPDDPRPPEPFAPRTLCERAYLQLRQDIVQGRISPGERLRVEHLKDRY
QVGAGTLRESLALLVSDALVTVEGQRGYRVTAISLDDLQDLTDTRVRLETEALRLSIRYG
DMQWEAQLRASFDNLRASEARGPSADPAGWEQANRRFHEALIAAHRSPWSQYLLKLLYRH
GERYRHVAIRLGTNQSVSRKVHEEHALIFEAAVARQEARAALALEAHIRLTYEFLSSARI
EM
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgccaaacgccgcagcgcccgcgacagcgtgccagacgaccctcggcctccc
gagcccttcgcgccgcgcaccctgtgcgagcgcgcctatcttcaattgcggcaggacatc
gtgcagggacgcatcagccccggcgagcgcctgcgggtcgaacacctcaaggatcgctat
caagtgggtgccggcacgctgcgagaatccctggcgctgcttgtgtccgatgcccttgtg
accgttgaaggccagcggggataccgggtcacggcgatctcgctggacgacctgcaggat
ctcactgacacgcgggtgcggttggaaactgaagcgcttcgtctttccattcgctacggc
gacatgcaatgggaagcgcagttgcgggcgtcgttcgacaacctcagagcctcggaggcc
cgtggcccgtcggcggacccggccggctgggagcaggccaaccggcgctttcatgaagcc
ctgatcgccgcgcaccgctcgccgtggagtcaatatctgctgaagctcctttaccgtcac
ggggaacgctaccggcacgttgccatccgcctcgggacgaaccaatcagtctcccggaaa
gtgcatgaggaacatgcgctcatcttcgaggccgccgtggcgcgccaggaagcgcgcgct
gcgctcgcactggaggcacatattcgccttacctatgagtttctgtcgagcgcgcgaatt
gaaatgtaa

DBGET integrated database retrieval system