KEGG   Ralstonia eutropha JMP134: Reut_B5673Help
Entry
Reut_B5673        CDS       T00268                                 

Definition
(GenBank) Helix-turn-helix, Fis-type
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat XylR_N V4R Sigma54_activ_2 HTH_8 HTH_30 AAA_5 Mg_chelatase HTH_1 HTH_28 AAA MCM HTH_29 HTH_psq RsgA_GTPase HTH_23
Motif
Other DBs
NCBI-ProteinID: AAZ65018
UniProt: Q46PB6
Position
2:complement(2505787..2507565)
Genome map
AA seq 592 aa AA seqDB search
MAKRHPGKPKSGSPAQGHPGRNQKRESPEAIRVPAIHDLAKRLRFAPQQGRIWLDDQRMM
LMHISSLGALRQELIESLGKETARGLITRIGYQAGTRDAAMARKVRAGLNTYDDFLAGPQ
LVSLEGMVHCEPVALDIDVQRGHYFGDFYLVDSSEAEAHIAGYGIGNESVCWMLIGYACG
YTSAFMGRPILWRETECRGMGHVKCRVVGKPVEEWEDAQDDLRFLRIGDFVKWAPVDEAP
LPATSRIAARLSSAPENSFGVVGISAGFNTVCHMVNKVAPTDATVLFLGESGVGKEVFAN
NLHRLSKRADGPYVAVNCASIPEHLMESELFGVERGGFTGATTSRAGRFERADGGTLFLD
EVGTLSFTAQGKLLRALQQGEIERVGDTRTRKVNVRVVAATNVNLREAVKAGHFREDLFF
RLNVFPIQVPPLRERRDDIPLMMNWFLQRMARKHDKHITGFRERAVDAMFAYDWPGNVRE
LENMIERAVILAEDGGALDLCHLFTSGEEVDTTAFMLKRSGSIGRVSEASEAESPPSAAE
GRPGLAETEVAMLRAAVAEANGNLSRAARVLGISRPTLAYRLQKYGITPEAQ
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaggcatcccggaaaacccaagtccggctcaccggcgcaaggccatcccggc
cggaatcagaagcgcgagtcccccgaggcaatccgggtgccggcgatccacgacctcgcc
aagcgcctgcgcttcgcgccgcaacagggtcgcatctggttggacgaccaacgcatgatg
ctaatgcacatcagctctcttggcgccttgcggcaagaactgatcgaaagccttggcaag
gaaacagcgcgcggactgatcacccgtatcggctaccaggccggcacgcgggacgcagcg
atggcgcgcaaggtccgcgccggcctgaacacctatgacgacttcctggccggtccacaa
ctggtctcgctggagggtatggtgcattgcgaaccggtggcgctggacatcgatgtccag
cgtggccactacttcggcgatttttatctggtggacagctccgaggcggaagcccacatc
gccggctatggtatcggcaatgaatccgtgtgctggatgctgatcggttatgcatgcggc
tataccagtgccttcatgggccgtcccatcctgtggagggaaaccgaatgccgggggatg
gggcatgtgaaatgccgcgtggtaggcaagccggtggaggaatgggaagacgcccaggac
gacctgcgcttcctgaggatcggcgatttcgtcaaatgggcaccggtggacgaggcgccc
ctgcccgccacgagccgcatcgcggcgcggctgtccagcgccccggagaacagcttcggc
gtggtcggcatctccgccggcttcaacaccgtctgccacatggtcaacaaggtggcgccc
accgacgccaccgtgctgttcctgggggaaagcggtgttggcaaggaagtctttgcgaac
aacctgcatcgcctgagcaagcgcgccgacggcccttacgtcgcggtgaactgtgcgtcc
attccggaacacctgatggaatccgagttattcggcgtcgagcgcggcggctttacgggc
gccaccacatcccgcgccggccgcttcgagcgggccgatggtggcacgctgtttctcgac
gaggtcggcacactgagcttcacggcacagggaaagctgctgcgcgcgctacagcagggt
gagatcgagcgtgtgggcgatacacgcacccggaaagtcaacgtcagggtggttgccgcc
acgaacgtgaacctgcgtgaagctgtcaaggctggccacttccgcgaggatctgttcttc
cggctgaacgtctttccgatccaggtgccgccgctgcgagagcgccgcgacgacatcccg
ctgatgatgaactggttcctccagcgcatggcacgcaagcatgacaagcacatcaccggc
ttccgcgaacgcgccgtggacgcgatgttcgcctatgactggcccggcaacgtccgagag
ctggagaacatgatcgagcgcgcggtcattctggccgaggacggtggcgcgctcgacctg
tgccacctgttcaccagcggcgaggaagttgataccaccgctttcatgctgaagcgcagc
ggcagcatcggacgcgtcagcgaagccagcgaagcggaatcgccgccgagcgctgccgaa
gggcgacctggtctggccgaaacggaggtggccatgctgcgtgcagccgttgccgaagcc
aacggcaatctgtcgcgcgcagcccgggtgttgggaatcagccgtccgacgctggcgtac
aggctgcagaaatacggcattacgcctgaagcgcaatga

DBGET integrated database retrieval system