KEGG   Ralstonia eutropha JMP134: Reut_B5676Help
Entry
Reut_B5676        CDS       T00268                                 

Definition
(GenBank) toluene 4-monooxygenase protein D
  KO
K15763  toluene monooxygenase system protein D [EC:1.14.13.236 1.14.13.-]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    Reut_B5676
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     Reut_B5676
    1.14.13.-  
     Reut_B5676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MmoB_DmpM
Motif
Other DBs
NCBI-ProteinID: AAZ65021
UniProt: Q46PB3
Position
2:complement(2509858..2510175)
Genome map
AA seq 105 aa AA seqDB search
MSKDHNTAEAYRNNRVGPVLRASSITSGVIEAAQEDNPGKEIRVDDKLAYVRIDTDGELI
LRRATLEDALGRPFRMSELEVNLSSFAGRIETTDDYVRFYYEKTL
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagaccacaacaccgccgaggcctaccgaaacaaccgcgtcggccccgtactg
cgcgcgagcagcatcacgtccggcgtcatcgaggccgcgcaggaagacaacccagggaag
gaaatccgcgtcgacgacaagctcgcatacgtgcgcatcgacaccgacggcgaactgatc
ctgcgccgggccacgctggaggatgcgctgggccgcccgttcaggatgtccgagctggag
gtcaacctcagctcgttcgcgggccgcatcgagactacggacgactacgtccgcttctat
tacgaaaagacgctgtaa

DBGET integrated database retrieval system