KEGG   Ralstonia eutropha JMP134: Reut_B5682Help
Entry
Reut_B5682        CDS       T00268                                 

Definition
(GenBank) phenol 2-monooxygenase P2 subunit
  KO
K16244  phenol hydroxylase P2 protein
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00361  Chlorocyclohexane and chlorobenzene degradation
reu00362  Benzoate degradation
reu00623  Toluene degradation
reu01100  Metabolic pathways
reu01120  Microbial metabolism in diverse environments
reu01220  Degradation of aromatic compounds
Module
reu_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5682
   00361 Chlorocyclohexane and chlorobenzene degradation
    Reut_B5682
   00623 Toluene degradation
    Reut_B5682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MmoB_DmpM
Motif
Other DBs
NCBI-ProteinID: AAZ65027
UniProt: Q46PA7
Position
2:2514253..2514522
Genome map
AA seq 89 aa AA seqDB search
MSQVFIAFQANEESRPVVEAIVTDNPEAVVSYPTGLVKIDAPGRLTIRRETIEEQTGRPF
DLQQLHVNLVTLSGHIDEDDDQLTLSWNH
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggtctttatcgccttccaggccaatgaggaatcgcgtccggtcgtcgaagcg
atcgtgactgacaaccccgaggcggtcgtcagctatcccacggggctcgtcaagatcgat
gcccccggccggctcaccatccgtcgcgaaaccatcgaggaacagaccggccggcccttc
gacctgcagcagcttcacgtaaatctggtcacgctgtcgggccacatcgacgaagacgac
gaccagctcacgttgagctggaaccactga

DBGET integrated database retrieval system