KEGG   Ralstonia eutropha JMP134: Reut_B5705Help
Entry
Reut_B5705        CDS       T00268                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
reu  Ralstonia eutropha JMP134
Brite
Enzymes [BR:reu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     Reut_B5705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2532753..2533727)
Genome map
AA seq 324 aa AA seqDB search
MEEKMFAPVTGTVTPRYAGLATLMRLPHIELMSENIPDVDIGLIGVPWDGGTTNRPGARH
GPRQVRDISTMVRNVNRSSGIKPFEICNCADLGDTPVNPVDLIDSMNRITAFYDAVCRAN
IAPLSVGGDHLVTLPILRALATDGPVGMVHFDAHTDTWNRYFGDNLYTHGTPFRRAIEEG
LLDPKRTIQIGIRGALYNDSENDWGERQGIRVIDMDEFRSMGVEAVIQEAWRVVGNGRTY
VTFDVDALDPVYAPGTGTPEIGGLTTIEAQHMIRGLRGLNLIGGDVVEVSPPFDPTGNTA
LVAATLMFEILCVLAANISKQKRR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaatgtttgcgccggtcaccggtacagtgacgccacgttatgccggtttg
gctacattgatgcggctgccgcacatcgaactgatgagcgagaacattccagatgtggat
atcgggttgattggggtgccatgggatggtggtaccaccaatcgtccgggcgcccgacat
ggccctcgtcaggtgcgtgatatctcgacgatggtgcgcaatgtcaaccgaagcagcggt
atcaaaccatttgagatctgcaattgcgcggacctaggggatacgcctgtcaatccggtg
gatttgatcgattcgatgaatcgcatcaccgcgttctacgacgcagtgtgcagggctaat
atagcgccactatcggtgggtggagatcacctggtaacgttgccgatcttgcgggcgctt
gcaacggacgggcccgttggtatggttcactttgacgcgcatacagatacgtggaatcgc
tattttggcgataacctttacacacatggcaccccctttcggcgagcgatcgaagaggga
ttgctggatccgaaacggaccatacaaatcggtattcgcggggcgttgtacaacgacagt
gagaatgattggggagaacgtcagggcattcgagtcatcgacatggatgaatttcggtcg
atgggtgtcgaagccgtgatccaggaagcctggcgtgtagttggaaacggccgcacgtat
gtgaccttcgatgtcgatgcactggatcccgtatacgcccccggcactggcacaccggaa
atcggtgggctgacaacgatcgaggcccagcacatgattcgtggactacggggcctgaat
ctcatcggaggtgacgtggttgaagtgtcgccgccgtttgatccaactggcaatacggca
ttggtcgctgccacgttgatgttcgagattctatgtgttctagctgccaacatcagcaag
caaaaacgccgctag

DBGET integrated database retrieval system