KEGG   Ralstonia eutropha JMP134: Reut_B5710Help
Entry
Reut_B5710        CDS       T00268                                 

Definition
(GenBank) SEC-C motif protein
  KO
K07039  uncharacterized protein
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0149 SEC-C
Motif
Other DBs
NCBI-ProteinID: AAZ65054
UniProt: Q46P80
Position
2:complement(2537115..2537960)
Genome map
AA seq 281 aa AA seqDB search
MRLAHPHPAPREPALMTEATALTPDELQELDDLLDDLRQRAEEIPQWEFCDGFLTALVCT
RRRIPAADYLPMLLGDGAALDVAEGSPLPLLPAFHEAAQQTRFMELWQRRWNEVEHQLDQ
PVETLEDERTFHPEAMDMRGAILSLPEEERAEIDGREIPSFGQVWALGFMFAVENWPEEW
ASPRDKEAAQWLDDALDAIVALTEDDTGQPEVCMYSEDGPPSTSQARVETFGEAIWAVYD
LRQIWKSLGPRVEAVVRGDQPGRNDPCPCGSGKKFKKCHGR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctagcgcatccccaccccgcaccgcgagaacccgccctcatgaccgaagccacc
gccctgacgcccgacgaactccaggagcttgacgatctgctggacgacctgcgccagcgc
gctgaggaaatcccgcaatgggagttctgcgacggctttctcacggccctggtctgcacg
cgccgccgcatcccggctgccgactacctgcccatgctgctgggcgacggcgcggcgctc
gacgtggccgagggcagcccgctgccgttgctgcccgcgttccatgaagcggcccagcag
acccgcttcatggagctgtggcagcgtcgatggaacgaggtggagcatcagctcgaccag
cccgtggagacgctggaggacgaacgcaccttccatcccgaagccatggacatgcgcggc
gccatcttgagcctgcccgaggaagagcgcgccgagattgacgggcgggaaatcccgtcg
tttggccaggtgtgggcgctgggcttcatgttcgcggtagagaactggcccgaggaatgg
gcctccccacgcgacaaggaagccgcccagtggttggacgacgcgctcgacgccattgtc
gccctgaccgaggacgacaccggccagcccgaggtctgcatgtacagcgaggatggcccg
cccagcaccagccaggcgcgcgtggaaaccttcggcgaggcgatctgggcggtctacgac
ctgcgccagatctggaagagcctgggcccgcgcgtggaggccgtggtgaggggcgaccag
cccggtcgcaacgacccgtgcccttgcggcagcggcaagaagttcaagaagtgccacggg
agataa

DBGET integrated database retrieval system