KEGG   Ralstonia eutropha JMP134: Reut_B5735Help
Entry
Reut_B5735        CDS       T00268                                 

Definition
(GenBank) hypothetical protein
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ65079
UniProt: Q46P55
Position
2:complement(2563650..2564099)
Genome map
AA seq 149 aa AA seqDB search
MSEDLNQEKLRQLAATVATQIAEEDRSAVLALMRQLLVIRDSALPRYEQARAAYRATAQS
GGAWALAKMAAGALKEYAWDSRSTSTRLGLSGLAIVAAAFARRGLGIAAVGALFGVPLWI
VFGAGGQFPDLLIEELSKMEKPNGRDDAQ
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaagatctcaatcaggagaagctgcgccagctcgctgccaccgtagccacccag
atcgccgaagaggaccggtccgctgtcctcgcattaatgcgtcagctcttagtgatccgc
gacagcgcactgccccggtatgaacaggcgcgcgcggcttaccgagcgactgcgcaaagt
ggcggagcctgggctctcgcgaagatggcggctggggctctcaaggaatacgcctgggac
agccgtagcacgtccactcggcttgggctttcaggtctcgccatcgtcgcggccgcgttc
gcccgtcgaggcttaggaattgcggcggtgggggcgttatttggcgtccccctctggatc
gtgttcggcgccggcggccagttccctgacctactgattgaggaactctctaagatggaa
aaaccaaacggcagggacgacgcgcaataa

DBGET integrated database retrieval system