KEGG   Ralstonia eutropha JMP134: Reut_B5737Help
Entry
Reut_B5737        CDS       T00268                                 

Definition
(GenBank) conserved hypothetical protein
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ65081
UniProt: Q46P53
Position
2:complement(2564987..2565358)
Genome map
AA seq 123 aa AA seqDB search
MSTFTARDRASAVERIHGRAAGTLELDYENAWQDAVELEQLGRQFGVDVQYRAVEHVSVA
SPEALVRGLRMEKATFRQRYLYCRFDMAALSEDTLRDLEDLAIEHGDYLMPANLFTEATL
TWM
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatttaccgcacgcgaccgagccagcgcggtggaacgcatccatggtcgcgct
gccggcacgcttgagttggactacgagaacgcttggcaggatgcggttgagcttgagcaa
ctcggccgacaattcggtgtcgacgtccagtaccgcgccgtcgagcatgtctccgtggca
tcccccgaagcattggtgcgcggcctgcgcatggaaaaggccacattcaggcagcgctac
ctctactgcaggtttgacatggccgcgctgtctgaggatacgctgcgcgatctggaagat
cttgccattgaacacggcgactacctcatgcccgctaacctctttacggaggcaacgctg
acttggatgtga

DBGET integrated database retrieval system