KEGG   Ralstonia eutropha JMP134: Reut_B5746Help
Entry
Reut_B5746        CDS       T00268                                 

Definition
(GenBank) hypothetical protein
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ65089
UniProt: Q46P45
Position
2:2569834..2570187
Genome map
AA seq 117 aa AA seqDB search
MGTPGKFMQDATRRPPFAQPPNRQLLISQSFAGIDATDVWQGRRFSARPIAKLASAFVAA
LPRFGLAEPCSHRDEDAVTISSNAIWVEMITRWQWKIGAHNDDNFSTLPSLCQRGKR
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggggactcctggaaaattcatgcaagatgccacgcggcgaccgccgttcgcccagccc
cccaatcgtcagttattaataagtcagtctttcgccgggatcgatgcaaccgatgtctgg
caagggagacgcttctccgcaagaccgattgcaaagttggcttccgccttcgtggctgct
ctcccgcgtttcgggctggcggagccgtgctctcatcgtgatgaagatgccgtgacgatc
tccagcaacgcgatatgggtggaaatgattacccgctggcaatggaagatcggtgcccac
aacgatgacaatttttcaacactgccatcactgtgccagcgtggcaagcgatga

DBGET integrated database retrieval system