KEGG   Ralstonia eutropha JMP134: Reut_B5753Help
Entry
Reut_B5753        CDS       T00268                                 

Definition
(GenBank) conserved hypothetical protein
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1488
Motif
Other DBs
NCBI-ProteinID: AAZ65096
UniProt: Q46P38
Position
2:2573518..2573769
Genome map
AA seq 83 aa AA seqDB search
MALSFPNPSRSYDGTRHGVWFWGYDNAREITFLVEDRVLMNFDSALGSDEAGVLASFDRH
RNEILKIAMALYVEGRQTLYTLH
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagttttcccaaccccagccgcagctatgatggaaccaggcatggcgtgtgg
ttctggggttacgacaacgcacgcgaaattaccttccttgtggaagaccgcgtactgatg
aatttcgactccgctctcggttctgacgaagccggggtgctggcctccttcgaccggcat
cgcaatgagatcctgaagatcgccatggccctctatgtcgaggggcggcagactctctac
accctgcattaa

DBGET integrated database retrieval system