KEGG   Ralstonia eutropha JMP134: Reut_B5762Help
Entry
Reut_B5762        CDS       T00268                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 MarR_2
Motif
Other DBs
NCBI-ProteinID: AAZ65105
UniProt: Q46P29
Position
2:2585547..2586455
Genome map
AA seq 302 aa AA seqDB search
MLPTLKQIQHFVAIAETGQVSRAAQRCHVSQSSMTASLKALEEVVGAPLFSRHAAGVKLT
AAGIRFLRHAQQIDVAVREAVSAAAVAPATLTGVVRLGVTETITAYVLPKLLPALEQKFP
QLELQILERPRGDIEAHIETGKLDLALLLVSNLPEMQHVGCETLLRSARQLWGHPDHPLM
QQEEISLSDVAQHDYILLDMDEHIATVIKYWGQYGLSPSVRLQSCSIEAVRSLVASGRGV
SILSDLVYRPWSLEGQRILRRGLSDRVPSMDVGLIWRLDAGADPQTQSLREFLRVALRET
LR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgacactgaaacagatacagcactttgttgccattgccgagaccggacaggtg
tcgcgcgccgcacagcgctgccacgtttcgcagtcctcgatgacggcatcgctcaaggcg
ctggaggaggtcgtgggcgcgccgctgttctcgcggcacgccgccggggtaaagctgact
gctgcgggcattcgcttcttgcgccatgcgcagcagatcgacgtggccgtgcgcgaggca
gtcagtgcggccgcggtcgcccctgcaacgctgacaggcgtcgtccgcctcggcgtcaca
gagaccatcacggcatacgttctgcccaagctgttgcccgccctcgaacagaagtttccg
caactggaactgcagatattggagcgaccgcgcggcgatatcgaggcgcatatcgagaca
ggcaagctcgacctcgctttgctactggtttccaacctgcctgaaatgcagcacgttggc
tgcgaaacgctgctgcgctcggcgcgtcagctctgggggcatccggaccatccgctgatg
cagcaggaagagataagcctgtccgacgtggcgcagcacgactatatcttgctggacatg
gacgaacatatcgccaccgtgatcaagtattggggacagtacgggctttcgcccagcgtg
cggctgcaaagctgttcgatcgaggccgtgcgcagtctggtggcgtcggggcgcggcgta
tcgatcctctccgatctcgtttaccgaccctggtcgcttgaagggcagcgcattctgcgg
cgcggcctttctgacagggtgccgtccatggacgtcggattgatctggcggctcgatgcc
ggagcagacccgcagacgcaaagcctgcgggaatttttgcgggttgcgctgagggaaacg
ctacgctag

DBGET integrated database retrieval system