KEGG   Ralstonia eutropha JMP134: Reut_B5785Help
Entry
Reut_B5785        CDS       T00268                                 

Definition
(GenBank) transcriptional regulator, GntR family
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntR FCD
Motif
Other DBs
NCBI-ProteinID: AAZ65128
UniProt: Q46P06
Position
2:2609418..2610113
Genome map
AA seq 231 aa AA seqDB search
MGRREVFDPAVGLTPRATDTDLPSRLAADIREMINEGKLSPGQQLRQQDLARRFGISRVP
VRETLSLLVAEAAVCHDPNRGFHVAPLSSSEARQLYRIRHLLETQLLSTVRWPDASELAD
LRARLALLDHHLTERARAAWVRAHREFHGAIFALSPDAVLRREVMRLMRQTDRYRAMAAP
DIAGYRFPADPEHHLVETLAAQDREALLDAYRRDRSAVEKRLLASLTARAL
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgggccggcgcgaagtgttcgatcctgctgtgggcctgacgccacgcgccaccgatacc
gacttgccgtcgcggctcgcggccgatatccgcgaaatgatcaacgaagggaaactgtcg
cccggacagcagttgcggcagcaggacctggcccggcgattcggcatcagtcgcgtgccg
gtgcgggaaacgctgagccttttggttgccgaggctgcggtctgccacgaccccaatcgc
ggcttccacgttgcgccgctgtcgagtagcgaggcgcggcaactctatcgcatacgacat
ctgctcgagacgcaactgctgtcgacggtgagatggcccgacgccagcgaactggcggac
ctgcgcgcgcggcttgcgctgctcgaccaccatctcacggagcgcgcccgggccgcgtgg
gtgcgcgcacaccgggagttccacggtgccatctttgccttgtcgcccgacgcggtgcta
aggcgtgaagtgatgcgactgatgcggcagacggatcgatatcgcgccatggccgcgcca
gatattgccggctatcgtttccccgccgatccggaacatcatctcgtcgagacgctcgcc
gcacaagaccgcgaggcgttgctggatgcctaccgccgcgaccgcagcgcggtggaaaag
cgcttgctggcgtcgctgaccgcgcgcgctctctga

DBGET integrated database retrieval system