KEGG   Ralstonia eutropha JMP134: Reut_B5797Help
Entry
Reut_B5797        CDS       T00268                                 

Definition
(GenBank) Protein of unknown function DUF894, DitE:Major facilitator superfamily MFS_1
Organism
reu  Ralstonia eutropha JMP134
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_3 MFS_1
Motif
Other DBs
NCBI-ProteinID: AAZ65140
UniProt: Q46NZ4
Position
2:2620331..2621590
Genome map
AA seq 419 aa AA seqDB search
MVSHMQLPHGLRALSSRSFRLFMAGQGAAQVGNWQQLIATSWLAYALSGSTLVLGLAAFA
LQIPFLLMAPVTGPLLDRLDTRRVLMVANAVACMQSVAMLSLVATGLLRPWHIVVANLVL
GIVNAFDSPARQSLLSQMVERKEDLANAIALNSSMMAGARFVGPTIAGAIIATFGQVWAF
AANAILRFSIIAALRAMRVAPAQRAAQPEPWLRQFAAGLRYANRFTPCRNSLWLLATMSF
TIQTHAAMMPWFVRERFHGDSRTLGMLLGAAGLGALAGMLYLAMRRGVGWLLATIGFASV
MAACAAIGFAQAPVVWMGFVMLFLVGMGTMLAAASVNTLIQLAAPDGFRGRVASLYVVAF
LGISPVGALFWGWTAEYVGTPAALTTCGVVLLLASALYMTNVAAMREQVQPVYSRMNLS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcccacatgcagttaccccacggcctccgcgcactctcctcccgcagcttccgc
ctgttcatggcggggcagggtgccgcgcaagtgggcaactggcagcagttgattgccacg
tcctggctggcctatgcgctctccggttcgacgctggttcttggcctggccgccttcgcg
ctgcagattccctttctgctgatggcgccggtgacggggccgctgctggaccgtctcgat
acccggcgcgtgctgatggtggcgaatgccgtcgcgtgcatgcagtcggtggcgatgctg
tcgctggtggcaaccggcctgctgcggccctggcatattgtggtggcgaacttggtgctc
ggcatcgtgaatgcgtttgattcgccggcgcggcaatcgctgttgtcgcagatggtggag
cgcaaggaagatctcgccaacgccatcgctctcaattccagcatgatggcgggtgcccga
ttcgtcggcccgacgatcgctggggccatcatcgccacgttcggccaggtgtgggcgttc
gcggccaacgcgatcctgcgcttttcgatcatcgcggcgctgcgcgccatgcgcgtggcg
ccggcgcagcgcgcggcgcagccggagccttggctcaggcagttcgcggctgggctgcgc
tatgcgaatcgcttcacgccctgccgcaacagcctgtggctgctggcaacgatgagcttt
accatccagacccatgccgcaatgatgccgtggttcgtgcgggagcgcttccacggggac
tcgcgcacgctgggcatgctgcttggcgcggcggggcttggcgcgctggccgggatgctg
tatctggcgatgcggcgcggtgtcggctggctgttggcgacgatcggcttcgcctccgtc
atggctgcctgcgccgccatcgggttcgcccaggcgccggtggtctggatggggttcgtg
atgctgtttctcgtcggcatgggtaccatgctcgcagcggcttcagtcaataccctgatc
cagctcgcggcgccagatggctttcgcggcagggtcgcgtcgctgtacgtcgtggcgttc
ctgggcatttcacccgtgggcgccttgttctggggctggacggcggagtacgtcggcacg
ccggctgcgctgacgacctgcggcgtggtgttgttgttggcatcggcgctgtacatgacg
aacgtcgccgccatgcgcgagcaggttcaaccggtgtacagtcgcatgaacctgtcatga

DBGET integrated database retrieval system