KEGG   Ralstonia eutropha JMP134: Reut_B5824Help
Entry
Reut_B5824        CDS       T00268                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Reut_B5824
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Reut_B5824
   00650 Butanoate metabolism
    Reut_B5824
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Reut_B5824
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Reut_B5824
   00622 Xylene degradation
    Reut_B5824
   00621 Dioxin degradation
    Reut_B5824
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Reut_B5824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2652501..2653442)
Genome map
AA seq 313 aa AA seqDB search
MATRKLKAAIIGSGNIGTDLMIKILRHGKHLEMGAMVGIDPASDGLARAARMGVATTHEG
VEGLISLPNFADIDVVFDATSAGAHVKNDARLREVKPGIRMIDLTPAAIGPYCVPVVNLD
DRLDALNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTETT
SKAIEVIGGAAKGKAIIVLNPAEPPLIMRDTVYVLSAAANRAEVEASIEEMAAAVQQYVP
GYRLKQKVQFDEIPASAPLNIPGLGKFSGLKTSVFLEVEGAAHYLPAYAGNLDIMTSAAL
ATAERMAQAALTA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttggcgacaaggaaactcaaggccgcgatcatcggatccggcaatatcggcacggacctg
atgatcaagatcctgcgccatggcaagcaccttgagatgggcgccatggtcggcatcgat
ccggcatcggatggcctggcgcgtgctgcccgcatgggtgtggcgaccacgcatgaaggc
gtggaggggctgatcagcctgccgaatttcgccgacatcgacgtcgtcttcgacgccacc
agcgctggcgcccacgtcaagaacgacgcgcgcctgcgcgaagtcaagccgggcatccgc
atgatcgacctcaccccggcggccatcggcccctactgcgtgcccgtggtcaatctggac
gaccgcctcgacgcgctgaacgtcaacatggtcacctgcggcggccaggcaaccatcccc
atggtcgcggccgtgtcacgcgtcgcaaaggtccactacgccgaaatcgttgcatcgatc
tccagcaagtcggccggcccgggcacgcgcgccaacatcgacgagttcaccgagaccacg
tcgaaggcgattgaagtgatcggaggcgccgccaagggcaaggccatcatcgtgctgaac
ccggccgagccgccgctgatcatgcgcgacacggtctacgtgctgagcgccgccgccaac
cgcgcggaggtggaagcctccatcgaggaaatggccgccgccgtgcagcagtacgtgccc
ggctaccgcctcaagcagaaagtgcagttcgacgagattccggccagcgctccgctcaat
atcccgggcctcggcaagttcagcggcctgaaaacctcggtgttcctggaggtcgagggc
gccgcccactacctgcccgcctacgccggcaatctggacatcatgacctccgccgcgctg
gccaccgccgagcgcatggcgcaggccgcactgactgcttga

DBGET integrated database retrieval system