KEGG   Ralstonia eutropha JMP134: Reut_C6089Help
Entry
Reut_C6089        CDS       T00268                                 

Definition
zinc-containing alcohol dehydrogenase superfamily protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:reu01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:reu00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:reu00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:reu00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:reu00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:reu00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
mega:complement(230798..231811)
Genome map
AA seq 337 aa AA seqDB search
MKAIVYTQPDAVEVLDRDMPDLEPGEILLRIDASGICGSDLHAYHGHDPRRKPGLVLGHE
FAGTVIASSDEARMPVGQRVTANPLVTCGHCDYCLQGRDNLCANRGMVGMNRPGALSEYL
AIPIRCAIPIPDTLPSVSAALTEPAATALHAVNLTMRAMSRPLPEVSVLIIGGGAIGMLT
AALVTSYGCKRVCVAETNALRQASVSRHLGCEVIDPTVSPPPESAFDVVIDAVGAAPTRN
LAIAATRPGGVVMHIGLQAWSSEIDMRKLTLAELTLLGTYTYTMSDMHATVRALEQGNFG
SLEWVETRSLADGPAAFADLAAGRVAAGKVVLIPELA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatcgtctatacccaaccggacgccgtcgaggtactggaccgagacatgccg
gacctggagccaggtgagattctgttgcgcatcgatgccagcggcatttgcggctcggat
ctccacgcctaccatggtcacgatccccgtcgcaagccagggctggtgctcggccatgag
tttgcgggtactgtcattgcctcttccgatgaagctcgcatgcccgtcggtcagcgtgtg
acagcgaacccactcgttacatgcggtcactgtgactactgcctccagggacgtgacaat
ctctgcgccaatcgcggcatggttggcatgaaccggcccggcgcgctgtcggagtatctt
gcgatcccgattcgctgcgcaattccgattcctgacacgctgccgagcgtcagcgcagcg
ctgaccgagccagcggctaccgcgcttcatgccgtcaacctcacgatgcgagcgatgagt
cggcccttgccggaggtgagcgtgctgatcatcggcggcggagcaattggcatgctgacc
gctgccctagtgacgtcttacggctgcaaacgtgtctgcgtcgcagagaccaatgccctc
cgacaggcgtcggtaagccggcatcttggatgcgaggtgatcgatccaacggtcagtccg
ccacccgaatccgcgttcgacgttgtcattgatgcggttggtgccgctccaacccggaac
cttgccattgccgcgacgcgacctgggggtgttgtcatgcatatcggcttgcaggcgtgg
tcgagcgagatcgatatgcgcaaactgacccttgccgagttgacgctgctgggaacttac
acctacacgatgtccgacatgcacgccacagttcgggcactggagcaaggcaattttggc
tcgctggagtgggtagagacccgttccttggcagatggcccggccgcctttgctgatctc
gctgcgggtcgtgtggcggcggggaaggttgtattgattcctgagctcgcctaa

DBGET integrated database retrieval system