KEGG   Ralstonia eutropha JMP134: Reut_C6089Help
Entry
Reut_C6089        CDS       T00268                                 

Definition
zinc-containing alcohol dehydrogenase superfamily protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Reut_C6089
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_C6089
  Lipid metabolism
   00071 Fatty acid degradation
    Reut_C6089
  Amino acid metabolism
   00350 Tyrosine metabolism
    Reut_C6089
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Reut_C6089
   00626 Naphthalene degradation
    Reut_C6089
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Reut_C6089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
mega:complement(230798..231811)
Genome map
AA seq 337 aa AA seqDB search
MKAIVYTQPDAVEVLDRDMPDLEPGEILLRIDASGICGSDLHAYHGHDPRRKPGLVLGHE
FAGTVIASSDEARMPVGQRVTANPLVTCGHCDYCLQGRDNLCANRGMVGMNRPGALSEYL
AIPIRCAIPIPDTLPSVSAALTEPAATALHAVNLTMRAMSRPLPEVSVLIIGGGAIGMLT
AALVTSYGCKRVCVAETNALRQASVSRHLGCEVIDPTVSPPPESAFDVVIDAVGAAPTRN
LAIAATRPGGVVMHIGLQAWSSEIDMRKLTLAELTLLGTYTYTMSDMHATVRALEQGNFG
SLEWVETRSLADGPAAFADLAAGRVAAGKVVLIPELA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatcgtctatacccaaccggacgccgtcgaggtactggaccgagacatgccg
gacctggagccaggtgagattctgttgcgcatcgatgccagcggcatttgcggctcggat
ctccacgcctaccatggtcacgatccccgtcgcaagccagggctggtgctcggccatgag
tttgcgggtactgtcattgcctcttccgatgaagctcgcatgcccgtcggtcagcgtgtg
acagcgaacccactcgttacatgcggtcactgtgactactgcctccagggacgtgacaat
ctctgcgccaatcgcggcatggttggcatgaaccggcccggcgcgctgtcggagtatctt
gcgatcccgattcgctgcgcaattccgattcctgacacgctgccgagcgtcagcgcagcg
ctgaccgagccagcggctaccgcgcttcatgccgtcaacctcacgatgcgagcgatgagt
cggcccttgccggaggtgagcgtgctgatcatcggcggcggagcaattggcatgctgacc
gctgccctagtgacgtcttacggctgcaaacgtgtctgcgtcgcagagaccaatgccctc
cgacaggcgtcggtaagccggcatcttggatgcgaggtgatcgatccaacggtcagtccg
ccacccgaatccgcgttcgacgttgtcattgatgcggttggtgccgctccaacccggaac
cttgccattgccgcgacgcgacctgggggtgttgtcatgcatatcggcttgcaggcgtgg
tcgagcgagatcgatatgcgcaaactgacccttgccgagttgacgctgctgggaacttac
acctacacgatgtccgacatgcacgccacagttcgggcactggagcaaggcaattttggc
tcgctggagtgggtagagacccgttccttggcagatggcccggccgcctttgctgatctc
gctgcgggtcgtgtggcggcggggaaggttgtattgattcctgagctcgcctaa

DBGET integrated database retrieval system