KEGG   Ralstonia eutropha JMP134: Reut_C6089Help
Entry
Reut_C6089        CDS       T00268                                 

Definition
(GenBank) Zinc-containing alcohol dehydrogenase superfamily
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
reu  Ralstonia eutropha JMP134
Pathway
reu00010  Glycolysis / Gluconeogenesis
reu00071  Fatty acid degradation
reu00350  Tyrosine metabolism
reu00625  Chloroalkane and chloroalkene degradation
reu00626  Naphthalene degradation
reu01100  Metabolic pathways
reu01110  Biosynthesis of secondary metabolites
reu01120  Microbial metabolism in diverse environments
reu01130  Biosynthesis of antibiotics
reu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Reut_C6089
  Lipid metabolism
   00071 Fatty acid degradation
    Reut_C6089
  Amino acid metabolism
   00350 Tyrosine metabolism
    Reut_C6089
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Reut_C6089
   00626 Naphthalene degradation
    Reut_C6089
Enzymes [BR:reu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Reut_C6089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N Glu_dehyd_C ADH_zinc_N ADH_zinc_N_2 FAD_binding_3 Pyr_redox_2 Shikimate_DH DAO Pyr_redox NAD_binding_8 2-Hacid_dh_C ApbA Sacchrp_dh_NADP HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AAZ65415
UniProt: Q46N56
Position
mega:complement(230798..231811)
Genome map
AA seq 337 aa AA seqDB search
MKAIVYTQPDAVEVLDRDMPDLEPGEILLRIDASGICGSDLHAYHGHDPRRKPGLVLGHE
FAGTVIASSDEARMPVGQRVTANPLVTCGHCDYCLQGRDNLCANRGMVGMNRPGALSEYL
AIPIRCAIPIPDTLPSVSAALTEPAATALHAVNLTMRAMSRPLPEVSVLIIGGGAIGMLT
AALVTSYGCKRVCVAETNALRQASVSRHLGCEVIDPTVSPPPESAFDVVIDAVGAAPTRN
LAIAATRPGGVVMHIGLQAWSSEIDMRKLTLAELTLLGTYTYTMSDMHATVRALEQGNFG
SLEWVETRSLADGPAAFADLAAGRVAAGKVVLIPELA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatcgtctatacccaaccggacgccgtcgaggtactggaccgagacatgccg
gacctggagccaggtgagattctgttgcgcatcgatgccagcggcatttgcggctcggat
ctccacgcctaccatggtcacgatccccgtcgcaagccagggctggtgctcggccatgag
tttgcgggtactgtcattgcctcttccgatgaagctcgcatgcccgtcggtcagcgtgtg
acagcgaacccactcgttacatgcggtcactgtgactactgcctccagggacgtgacaat
ctctgcgccaatcgcggcatggttggcatgaaccggcccggcgcgctgtcggagtatctt
gcgatcccgattcgctgcgcaattccgattcctgacacgctgccgagcgtcagcgcagcg
ctgaccgagccagcggctaccgcgcttcatgccgtcaacctcacgatgcgagcgatgagt
cggcccttgccggaggtgagcgtgctgatcatcggcggcggagcaattggcatgctgacc
gctgccctagtgacgtcttacggctgcaaacgtgtctgcgtcgcagagaccaatgccctc
cgacaggcgtcggtaagccggcatcttggatgcgaggtgatcgatccaacggtcagtccg
ccacccgaatccgcgttcgacgttgtcattgatgcggttggtgccgctccaacccggaac
cttgccattgccgcgacgcgacctgggggtgttgtcatgcatatcggcttgcaggcgtgg
tcgagcgagatcgatatgcgcaaactgacccttgccgagttgacgctgctgggaacttac
acctacacgatgtccgacatgcacgccacagttcgggcactggagcaaggcaattttggc
tcgctggagtgggtagagacccgttccttggcagatggcccggccgcctttgctgatctc
gctgcgggtcgtgtggcggcggggaaggttgtattgattcctgagctcgcctaa

DBGET integrated database retrieval system