KEGG   Rhodococcus erythropolis CCM2595: O5Y_03595Help
Entry
O5Y_03595         CDS       T02806                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rey00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    O5Y_03595
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O5Y_03595
   00650 Butanoate metabolism
    O5Y_03595
  Amino acid metabolism
   00360 Phenylalanine metabolism
    O5Y_03595
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O5Y_03595
   00622 Xylene degradation
    O5Y_03595
   00621 Dioxin degradation
    O5Y_03595
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     O5Y_03595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
782623..783525
Genome map
AA seq 300 aa AA seqDB search
MTKASVAIVGSGNISTDLLYKLQRSEWLEPRWMIGIDPESEGLARARKMGLETSAEGVDW
LLSQAEKPDLVFEATSAYVHREAAPRYEAAGIRAIDLTPAAVGPAVVPPANLREHLDAPN
VNMITCGGQATIPIVYAVSRVVDVAYAEIVASVASLSAGPGTRANIDEFTKTTSRGIETI
GGAQRGKAIIILNPADPPMIMRDTIFCAIPEDADQAAITDSIHRVVKDIQQYVPGYRLLN
EPQFDKPSVVSGGYATVTTFVEVEGAGDFLPPYAGNLDIMTAAATKVGEEIAQKLLSVKA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcaagtgtggcgatcgtcggatcgggaaacatcagtaccgatctgttgtac
aaactgcagcgttccgagtggctcgaaccgcgatggatgatcggaatcgatcccgagagt
gaaggattggcgcgcgcccgcaagatgggactcgagacctccgccgagggcgtcgactgg
ttgctcagccaggcggagaaaccggacctggtcttcgaggcgacgtcggcatacgtgcac
cgcgaggcagcaccacgctacgaggccgccggtatccgtgccatcgacctgactccggcc
gcggtcggcccggctgtggttccgccggcgaacctgcgtgagcacctggacgcacccaac
gtcaacatgatcacttgcggtgggcaggcaaccattccgatcgtctacgcggtatcgcgt
gtcgtcgacgtggcgtacgccgagatcgtcgcctctgttgcatcgttgtccgccggcccg
ggaactcgcgcgaacatcgacgagttcaccaagaccaccagccgcggtatcgagaccatc
ggcggcgcacagcgcggtaaggcgatcatcatcctcaatcccgcagacccgccgatgatc
atgcgcgacaccatcttctgcgctatccccgaagacgccgatcaggccgcgatcaccgac
tccattcaccgtgtcgtcaaggacatccagcagtacgtgcccggctaccggttgctcaac
gaaccgcagttcgacaaaccgagcgtcgtttccggtggctatgcaacggtcaccacgttc
gtcgaggtcgaaggtgcaggcgatttcctgccgccgtacgcgggcaacctcgacatcatg
acggcagcagccaccaaggtgggcgaggaaatcgcccagaagcttctgagtgtgaaggca
tga

DBGET integrated database retrieval system