KEGG   Rhodococcus erythropolis CCM2595: O5Y_05870Help
Entry
O5Y_05870         CDS       T02806                                 

Definition
L-amino-acid oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rey00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O5Y_05870
   00330 Arginine and proline metabolism
    O5Y_05870
   00340 Histidine metabolism
    O5Y_05870
   00350 Tyrosine metabolism
    O5Y_05870
   00360 Phenylalanine metabolism
    O5Y_05870
   00380 Tryptophan metabolism
    O5Y_05870
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     O5Y_05870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282083..1283687
Genome map
AA seq 534 aa AA seqDB search
MPYTRRSFMRSLGITGGAGLALGAMSSIGLAPAVASTPRRFQAPAAGDLIGKVKGNHSVV
ILGGGPSGLCSAYELQKAGYKVTVLEARNRPGGRVWSIRNGTEETDLNGETQTCTFSEGH
FYNLGATRIPQNHNTIDYCRELGVELQMFGNQNANTFVNYTGNKPLANQSITYRAAKADT
YGYMSELLQKATNQGALDQVLSKEDKEALSSFLTDFGDLSSDGRYVGSSRRGHSAEPGAG
LNFGTEIEPFGMSDVIQGGIGRAFSFEFGYDQAMTMMTPVGGMDRIYYKFQDAIGMDNIE
FGAEVSGMKNVPEGVTVDYVVDGNTKSITADYAICTIPPHLIKRLNNNLPSDILLALDAA
KPSSSGKLGIEYSRRWWETEDRIYGGASNTDRDISQIMFPYDHYNSDRGVVVAYYSSGKR
QQAFESLTHRQRLAKAIAEGAEIHGDKYTRDISSSFSGSWRRTKYSESAWASWAGAGDSH
GGMATPEYTKLLDPVDRIYFAGDHLSNAIAWQHGAFTSAQDVVTHLHQRVAQSA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgccatacacacgtagatctttcatgcgcagtctgggaatcaccggcggcgccggcctg
gcactcggtgctatgtcgtccatcggcctggcgccggcggtggcgtcgacgccgaggcga
tttcaggcacctgccgcgggtgacctgatcggaaaggtcaagggaaatcactccgtcgtg
atcctcggcggtggaccgtccggtctgtgctccgcctacgaactgcagaaggccggatac
aaggtcactgtcctcgaagcgcgcaaccggccgggtggtcgggtgtggtcgatccgcaac
ggcaccgaagaaaccgacctgaacggtgagacacagacctgtacgttctccgaggggcac
ttctacaacctcggtgcgacgcgtattccgcaaaatcacaacaccatcgactactgccgc
gaactgggcgtcgaactgcagatgttcggaaaccagaatgcgaacaccttcgtcaactac
accggcaacaagccgctggcgaatcagtcgatcacctaccgagcagccaaagccgacacc
tacggatacatgtccgagctgctgcagaaggccaccaatcagggcgctctcgaccaggtc
ttgagcaaggaagacaaagaagcactctcgtccttcctcaccgacttcggcgatctctcc
agcgacggccgctatgtcggatcctcgcgtcgagggcactccgccgagccgggcgccggc
ctcaacttcggaaccgagatcgaaccattcgggatgagcgatgtcatccagggcggcatc
ggacgtgcattctccttcgagttcggttacgaccaggccatgacgatgatgacccccgtc
ggcggcatggaccggatctactacaagttccaggacgcgatcgggatggacaacatcgag
ttcggtgccgaggtcagcggcatgaagaacgtgccggaaggcgtcaccgtcgactacgtc
gtcgacggcaacaccaagtcgatcaccgccgactacgcaatctgcacgatcccaccgcac
cttatcaagcggctgaacaacaacctgccctccgacatcctgctcgcgttggatgcagcc
aagccgtcgtcgtcgggcaagctcggtatcgaatactcgcgtcggtggtgggagacggag
gaccgcatctacggcggcgcgtcgaacaccgaccgcgacatctcccagatcatgttcccc
tacgaccactacaactccgaccgcggcgtcgtggtcgcgtactacagctcgggtaagcgt
caacaggctttcgaatcgctcacccaccgtcagcggctggcaaaggccatcgccgaaggc
gcagaaatccacggcgacaaatacactcgcgacatctcgtcgtccttctccggaagctgg
cgtcgcaccaagtattcggaatccgcctgggcatcatgggccggcgcgggagattcccac
ggcggcatggcaactcccgagtacaccaaactgctcgaccccgtcgaccggatctacttc
gccggcgatcacctctccaacgccatcgcctggcagcacggggccttcacgtccgcgcag
gacgtcgtcacccatctgcatcagcgtgttgcgcaatctgcctga

DBGET integrated database retrieval system