KEGG   Rhodococcus erythropolis CCM2595: O5Y_09840Help
Entry
O5Y_09840         CDS       T02806                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    O5Y_09840 (deoA)
Enzymes [BR:rey01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     O5Y_09840 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126679..2127974
Genome map
AA seq 431 aa AA seqDB search
MFDAVSIIGAKRDGRELSGTEIDWIVQAFTEGVVGDEQMSALAMAIYFRGMSRAETGRWT
EAMIESGGRMDFSDLPLPTVDKHSTGGVGDKITLPLAPLVAACGLAVPQLSGRGLGHTGG
TLDKLEAIPGWRAELTATEMVDILADPKIGAVICAAGANLAPADKKLYALRDVTGTVESI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKDLGDARELARTMVELGNDAGVRTSALIT
GMDTPLGLTAGNALEVRESVEVLAGGGPSDVVELTLVLAREMLSAAGIDGIDPADKLADG
TAMDRWRAMIAAQGGDPHATLPVARHSDVVTADRDGVLTRLDAMAVGVAAWKLGAGRERQ
GEAVQAGAGIEMHAKPGDVVRTGQKLMTLHTDTPERFDAARRSLGGGWSIGADSDTVSRP
LLIERIVGDSR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacgcagtttccatcatcggcgccaagcgtgacggccgcgagttgtcgggaacc
gagatcgactggatagttcaggcgttcactgagggggtcgtcggcgacgagcagatgtcg
gcgctcgcgatggcgatctatttccgaggaatgtcacgagcagagaccggccgatggacc
gaggcaatgatcgaatccggcgggaggatggacttttcggacttgccgctgcccactgtc
gacaagcattcgaccggtggtgttggggacaagatcacccttccgctcgcgcccctcgtc
gcggcatgtggtcttgcagtcccgcagttgtcgggacgcggactcggccacaccggcgga
actctcgacaagctcgaggccattccaggttggcgagccgagctcacggcgacggagatg
gtcgacattctcgcggacccgaaaattggcgcggtgatctgcgctgccggagcgaacctg
gcccccgccgacaagaagctctacgcgctgcgcgacgtgaccggaacggtggaatccatt
ccgctgatcgcaagttcgatcatgagcaagaagattgccgagggaaccggcgccctggtg
ctcgacgtcaaagtcggttccggagcgttcatgaaggacctcggcgacgcgcgagagttg
gcacgcacgatggtcgagttgggcaacgacgccggcgtgcgtacaagtgctctcatcacc
gggatggacaccccgctgggattgacggctggcaacgctctcgaggtgcgtgaatccgtc
gaggtgctggcaggcggcgggccgtccgacgtcgtcgagctgaccctggtcctggctcgg
gagatgctgtccgcggctgggatcgacggtatcgaccccgcagacaaactggccgacggc
acagccatggaccggtggcgcgcgatgatcgccgcacaaggtggggacccacacgcgacg
ctgccggtggcccggcacagcgacgtcgtcaccgcggaccgagacggcgtactgacccga
ctcgacgccatggcggtgggcgtcgcggcctggaagctcggagccggacgcgaacgacag
ggcgaagccgttcaggccggtgccggcatcgagatgcacgcgaagcccggcgacgtggtc
cgcaccggacagaagctgatgacactgcacaccgacactcccgagagatttgatgctgcg
cggcggagcctcggcggaggctggtcgatcggggccgattccgacaccgtttcgcgaccg
ttgctcatcgagcgaattgtgggtgattcgcgttag

DBGET integrated database retrieval system