KEGG   Rhodococcus erythropolis CCM2595: O5Y_17455Help
Entry
O5Y_17455         CDS       T02806                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rey00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    O5Y_17455
Enzymes [BR:rey01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     O5Y_17455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3824812..3825693
Genome map
AA seq 293 aa AA seqDB search
MSTPRIVVVGSINMDLTTSVARFPAPGETLLGTAFATAAGGKGSNQAIAAAKAGGDVSFI
GAVGDDGFGTQLRETLQDAGVDTALLRSVDGPSGVAAITVSDDAENNIIVVPGANSSITS
LTEADLDAIAHADILLCQLEIPVETVTAAAEHAHANGTTVILNPSPVQELPDPLIDAVDI
LIVNQTESEQLAAVTGRVRYLVTTLGAGGADLRSGEETIHADSPAVTPVDTTGAGDAFTG
AFAVEWVQDQDRALQFAATAGSLATTVRGASVSSPTRAEIEKVPNRQLDSDTV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcctcgaatcgtcgtcgtcggcagtatcaacatggatctgaccacgtcggtg
gccagattccccgctccgggagaaacgctgctcggcactgcctttgccaccgcggccgga
ggtaagggcagtaaccaggccatcgccgccgcgaaggccggtggggacgtgtccttcatc
ggcgcggtcggcgacgacggtttcgggacccaattgcgcgagaccctgcaagacgccggg
gtcgacaccgcactgctacgtagtgtcgacggcccgagtggcgtcgcggccatcaccgtg
agcgatgacgcggagaacaacatcatcgtcgtcccgggcgccaattcctcgatcacctcg
ttgaccgaagcagacctcgacgcgatcgcacacgccgacatcctcctgtgccaactcgaa
atcccggtcgagacagttacagcagcagccgagcacgcgcacgccaacgggacgacggtc
atcctcaatccgtctcccgtacaagaacttccggatccactgatcgatgcagtcgacatc
ttgatcgtcaaccagaccgagtcggagcagctggccgcggtcaccggtcgcgtccgatac
ctcgtcacgacgctcggagcgggcggcgcggatctccggtcgggcgaggagacaatccac
gccgactccccggccgtgacacccgtcgacaccaccggcgccggcgatgccttcaccggg
gccttcgccgtggagtgggtgcaggaccaggaccgcgccctgcagttcgctgccacggcg
ggaagtctggcgacgacggtccgcggcgcgtcggtgtcgtcgcccactcgcgctgagatc
gaaaaagtcccgaaccgacagcttgactctgacaccgtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system