KEGG   Rhodococcus erythropolis CCM2595: O5Y_18025Help
Entry
O5Y_18025         CDS       T02806                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rey00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    O5Y_18025
Enzymes [BR:rey01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     O5Y_18025
Exosome [BR:rey04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O5Y_18025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3961374..3963575
Genome map
AA seq 733 aa AA seqDB search
MPTEKSPSGIAPDNHDLELLARGEHHDPHSVLGAHPHADGTVLRALRPNAESVSAVIGGK
TFPLEHVSNGIFAALVPYPDLIDYRYSVTYPGGHTVLAADPYRFLPTLGELDLHLFGEGR
HERLWDILGAHPRSYETPDGPVDGTSFAVWAPAARGVTVVGDFDGWSGQFAPMRVLGSTG
VWELFLPDIAVGSLYKFRVHGHDGSVRDKADPMAFGTEVPPATASRVTTSSHEWNDAAWL
ETRAGVDPSQSPMSVYEVHLGSWRPGLDYRQMAEQLAVYVTETGFTHVELLPVSEHPFGG
SWGYQVTSYYAPTSRFGTPDDFRWFVDHLHAAGIGVIVDWVPAHFPKDEWALARFDGTPL
YEHADPRRGEQLDWGTYVFDFGRREVRNFLVANALFWLEEFHIDGLRVDAVASMLYLDYS
RPEGGWTPNIHGGRENLEAVAFLQEMNATVHKNHRGVVTVAEESTAWPGVTRATNVGGLG
FNMKWNMGWMHDTLGFLGHDPVHRSYHHHEITFSLMYAWSENYLLPISHDEVVHGKGTLW
TRMPGNDFAKASGLRSLLAYMWAHPGKQLLFMGQEFGQSAEWSEERGLDWWQLDDQYTGT
LHRGVQRLVGDLNSAYRRHPAMWTLDTSPGGYSWIDANDTENNVLSFLRYGTDGSIVACL
FNFSGSEHSSYRIGLPEPGRWVEILNTDAEVYGGSGVGNLGAVTATSRSWHGRPASAQVA
LPAAGAIWISLER
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccgaaaagtccccttcgggtatcgcgccggacaatcacgatctggaactgttg
gcgcgcggtgaacatcacgatccgcacagtgtcctcggcgcccatccccacgccgacggc
accgttctccgagcgttgcgtcccaacgccgagtccgtcagtgccgtcatcggcggcaaa
acctttcctctcgaacatgtttcgaacggaatattcgcggccctggtcccctacccagac
ctgatcgactatcgctattccgtgacgtacccgggtggccacacagttctcgcagccgac
ccttaccgattcctgccgactctcggtgaactcgaccttcacctgttcggcgaaggtcgg
cacgaacgactgtgggacatcctcggcgcacatccgcgttcgtacgagacaccggacgga
cccgtcgacggcacctcgttcgccgtctgggctccggccgcccgcggcgtgaccgtcgtc
ggcgacttcgacgggtggagtgggcaattcgcccccatgcgagtcctcggctccaccggg
gtctgggaactcttcctgcccgacatcgcagtcggttcgctgtacaagttccgggtccac
ggccacgacggctcggttcgcgacaaggccgatcccatggcattcggtaccgaggtaccg
ccggcgacggcgtcgcgagtgaccaccagttcgcacgaatggaacgacgcggcctggctg
gaaacccgcgctggtgtcgacccttcgcagtccccgatgagcgtgtacgaggtgcacctc
ggatcgtggcgtccgggactcgactaccggcagatggccgagcaactcgccgtatacgtc
accgaaaccggattcacccacgtcgaactgctgcccgtctccgagcatccgttcggtgga
tcgtgggggtaccaggtcacctcgtactacgcaccgacctcccgcttcggcaccccggac
gacttccggtggttcgtcgaccacctgcacgccgcagggataggcgtcatcgtcgactgg
gtgcctgcacacttccccaaagacgaatgggcgcttgcccgtttcgacggaacgccgttg
tacgagcacgccgatccgcgtcgcggcgagcagttggactggggcacatacgtattcgac
ttcggtcgccgcgaggtccggaacttcctcgtcgccaacgcgctcttctggctcgaggag
ttccacatcgacggactgcgcgtcgacgccgtcgcatcgatgctgtacctggactactca
cgtccggaaggtggatggactcccaacattcacggtggccgcgagaatctcgaagccgtt
gcgttcctgcaggagatgaacgccaccgtccacaagaaccaccgaggagtcgtcaccgtc
gccgaggagtcgacggcgtggcccggagtcactcgggcgaccaatgtcggtggcctcggg
ttcaacatgaaatggaacatggggtggatgcacgacaccctcggattcctcggtcacgac
ccggtgcaccggagttaccaccatcacgagatcactttctcgctgatgtacgcgtggagt
gagaactacctgctaccgatcagccatgacgaagtggtgcacggcaagggaactctgtgg
acccggatgcccggcaacgacttcgccaaggcttccggcctgcgctcactgcttgcgtac
atgtgggcgcatccgggcaagcaactgctgttcatgggacaggagttcggtcagagcgcg
gaatggtccgaagaacgcggcctcgactggtggcaactcgacgatcagtacaccggcact
ctccaccgcggcgtccagcgactggtcggagatctcaactccgcgtaccgacgccatccg
gcgatgtggaccctcgacacctcccccggcggatactcctggatcgacgccaacgacacc
gagaacaacgtcctcagttttctgcgttacggtactgacggttcgattgtcgcctgcctg
ttcaacttttcgggcagtgagcactcgagctaccgcatcgggctaccagagcccggccga
tgggtggaaattctcaacaccgatgccgaggtgtatggcggctccggagtcgggaacctc
ggagcggtcacggcaacgtcgcgttcgtggcacggtcggccagcctccgcacaggtggcg
ctgccagctgctggagcgatttggataagtctggagcgttga

DBGET integrated database retrieval system