KEGG   Rhodococcus erythropolis CCM2595: O5Y_20260Help
Entry
O5Y_20260         CDS       T02806                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rey00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    O5Y_20260
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     O5Y_20260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4478237..4479697
Genome map
AA seq 486 aa AA seqDB search
MADPTVRPISAADITTWDYEADVVVAGYGIAGVTAAIEAARAGAEVLVLERTGGWGGAAS
LAGGFIYLGGGTPLQKACGFEDSVENMKTFMKAALGPGTDDTKIDAYCEGSVDHYNWLVD
AGVPFKESFWGQPGWEPPYDDGLMYSGGENAAPFNALVDPAPRGHVPQMSEKKTGEQGGG
YMLMKPLVETAEKLGVRAEYDLRVQTLVVDGDRVVGVVAKRYGKDVAIRARKGVVLAMGS
FAYNNEMVRSNAPRIFGHPAASTEAHDGRAIQIGQALGADTAHMDATEVAFFCDPQLMVR
GILVNGRGQRYIPEDTYPGRIGQATLFQQDNQAFLVIDEAAYEEGMNAESSSAQLRAQPT
WVAETVEELEAEMGLPAGSLQSTVDLYNRHAAEGSDPVLGKKSEWVKPIVGPFAAIDLRG
RTGGFTLGGLKTTVDSEVLHVSGAPIPGLFAAGRCTSGVCAGGYASGTSLGDGSFFGRRA
GISAAR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggccgacccgaccgtcagaccgatctccgctgcagacatcaccacctgggactacgag
gccgacgtcgtcgtcgcgggatacggcatcgccggcgtcaccgctgcgatcgaagcagcg
cgtgcgggcgccgaggtgctcgtcctggagcggacgggcggttggggcggagccgcgtca
ctggctggtggattcatctacctgggcggtggaacgccgttgcagaaggcgtgcgggttc
gaggactcggtcgagaacatgaagacgttcatgaaggcagcgctcggccccggaaccgac
gacacgaagatcgacgcgtactgcgagggcagcgtcgatcactacaactggctcgtcgac
gccggcgtcccgttcaaggaatcgttctggggtcagcccggctgggaaccgccgtacgac
gacggcctcatgtactcaggcggcgaaaacgccgcaccgttcaacgcgctcgtcgatccc
gcgccccgcggacacgtcccgcagatgagcgagaagaagaccggcgagcagggcggcggc
tacatgctgatgaagccactcgtcgagacggccgaaaagctcggtgtccgtgcagaatac
gatctgcgtgtccagactttggtggtcgacggcgatcgggtcgtgggagttgtcgccaag
cgctacggcaaggacgtcgcgattcgtgcccgcaaaggcgtcgtgcttgcgatgggcagt
ttcgcgtacaacaacgagatggtgcgctcgaacgcaccgcgtatcttcggccacccggcg
gcctccaccgaggcgcacgacggccgcgcaatccagatcggtcaggctctgggcgccgac
accgcacacatggacgccaccgaggtcgcgttcttctgcgacccacagttgatggtgcgc
ggcattcttgtcaacggccgtggtcagcgatacatccccgaagacacctacccgggccgc
atcggacaggcaacactgttccagcaggacaaccaggcattcctcgtgatcgacgaagct
gcgtacgaggaaggcatgaatgccgaatcgtccagtgcgcagttgcgggcgcagccgacc
tgggtggcggaaaccgtcgaggaactcgaagccgagatggggcttcccgccggatcgctg
caatcgaccgtcgacctctacaaccgtcacgcggctgaagggtccgacccggtgctcggc
aagaagtccgagtgggtcaagccgatcgtcggcccgttcgcggcaatcgatctacgtggc
cgcacaggcggattcacgctgggaggattgaagacaaccgtcgattccgaggttctgcac
gtctcgggtgcgccgatccccggactattcgcagcggggcgctgcacgtccggtgtctgc
gcaggtggttacgccagcggaaccagtctcggcgacggcagcttcttcggacgtcgtgcc
ggaatcagcgcagcgcgctag

DBGET integrated database retrieval system