KEGG   Rhodococcus erythropolis CCM2595: O5Y_26025Help
Entry
O5Y_26025         CDS       T02806                                 

Definition
kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rey00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    O5Y_26025
Enzymes [BR:rey01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     O5Y_26025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5650517..5651782)
Genome map
AA seq 421 aa AA seqDB search
MTSTTTLSLDDCVKADAVDPLREFRREFAIPEGVLYFDGNSLGARPIAAQECAARVIGDE
WGNGLVRSWNEAGWFDLPVRLGDKLAPLLGAGEGEVVVTDSTSINLFKALASALSIAAAQ
DPSRKVIVSERDNFPTDLYIAEGIISLLDQGYELRLIDQPGDLTEAVGPDTAVVMLSHVN
YRTGNLYAMTEVTAAVQERGALMIWDLAHSAGAVTVDLSGADADFAVGCTYKYLNGGPGS
PAFIWVNRRHQNTGIQPLSGWWGHARPFAMESAYEPGAGIRLFLSGTQPITSLSLVECGL
DVMLKADMADIRSKSLALADLFINLVEERCAAYGLELITPRAHERRGSHVSFVHPEGYFI
MKALIARGVIGDYREPGVLRFGITPLYLGYADVWNAVDVLRDILENKSWDRPEFRERDAV
T
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgacaaccaccctttcgttggatgactgcgtcaaggccgacgcagtggatccc
ctgagggagttccgccgcgagttcgcgattccggagggcgttctctacttcgacggaaac
tcgctcggcgcgcgtcccattgccgcacaggaatgcgccgcgagagtaatcggcgacgag
tggggcaacggcttggttcgcagttggaacgaggctggatggttcgacctcccggtccgc
ctcggtgacaaactcgccccgttgctgggagcaggtgaaggcgaagtggtagtgacggat
tcgacgtcgatcaacctgttcaaggcattggcctccgcactgtccatcgcggctgctcag
gatcccagccggaaggtgatcgtctccgagcgcgacaatttccccactgacctctacatt
gcggagggcatcatctcgctgctcgatcagggatacgaactacgcctgatcgaccaaccg
ggcgacctcaccgaagcagtaggaccagacaccgccgtagtgatgttgtcgcacgtcaac
taccgcaccggaaacctgtatgcgatgacggaagtcactgcagcagtgcaggaacgtggc
gccctcatgatctgggatctcgcacactcggccggcgccgtcactgtcgatctgagcggc
gccgacgccgacttcgcggtcgggtgtacgtacaagtacctcaatggtggtccaggttca
cctgcattcatctgggtcaaccgtcgccatcagaacaccggaatccagccgctgtccggg
tggtgggggcacgcgcgaccgttcgcgatggagtcggcctacgaaccgggcgcaggaata
cgactgtttctgagtggtactcaaccaatcacgtcgttgtcactcgtcgagtgtggtctc
gacgtcatgctcaaagctgacatggccgacatccgcagcaagtcgctcgcgctggccgat
ctcttcatcaacctcgtcgaggagcgttgcgctgcctacggtttggagttgatcacgccg
cgcgcgcacgagcgtcgtggctcgcacgtgagttttgttcatcccgagggctatttcatc
atgaaggctctcatcgcgcggggcgtcatcggcgactaccgcgaaccaggagtgctgagg
ttcggtatcactccgctctatctcggatacgccgacgtgtggaacgccgtcgacgtgttg
cgagacatcctcgagaacaagtcctgggatcgccccgaattccgcgagcgcgacgcagtc
acctga

DBGET integrated database retrieval system