KEGG   Rhodococcus erythropolis CCM2595: O5Y_27510Help
Entry
O5Y_27510         CDS       T02806                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:rey00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rey00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:rey00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:rey00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:rey00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5972458..5973402
Genome map
AA seq 314 aa AA seqDB search
MSKVKVAIIGSGNIGTDLMIKVLRNSDYLEMGAMVGIDPASDGLARAARLNVPITAEGVE
GLIGLPNFDEIEIVFDATSAKAHVANNARLAPLGKRMIDLTPAAIGPYVVPAVNADEHLD
APNVNMVTCGGQATIPMVAAVSRVVPVAYAEIVASIASKSAGPGTRANIDEFTETTSEAI
VAVGGARRGKAIIILNPAEPPLIMRDTVFCLVDAPDPAVHEEIRQSIEKMVGDVSAYVPG
YRLKQEVQITEIPADQPVETLLVDGNRPTHQVSVFLEVEGAAHYLPAYAGNLDIMTSAGM
QIAERIAQQKEATK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcaaggtcgcgatcatcggatcgggcaacatcggcacggatctgatgatc
aaggtgctgcgcaactccgactacctggagatgggcgcgatggtcggcatcgacccagcg
tcggacggcctcgcccgcgcagcgcgtctgaacgtgccgatcacggctgaaggtgtcgag
ggtttgatcggtctgccgaacttcgacgagatcgagatcgtcttcgacgccacctcggca
aaggctcacgtcgccaacaacgcgcggctggctcccctcggcaagcgcatgatcgacctg
acgcctgccgccatcggcccgtacgtcgtgccggccgtcaacgcagacgagcacctggac
gcacccaacgtcaacatggtgacgtgtggtggccaggccacgatcccgatggttgcggct
gtttctcgggtcgtcccggtggcgtatgcggagatcgtggcgtccatcgcctcgaagtcc
gccggtcccggaacgcgcgccaacatcgacgagttcaccgagaccacatccgaggcgatc
gtggcagtcggcggcgcccgccgcggcaaggccatcatcatcctcaaccccgccgagccg
ccgctcatcatgcgcgacacggtgttctgcctcgtcgacgccccggacccggctgttcac
gaggagatccgtcagtccatcgagaagatggtcggcgacgtctccgcctatgttccgggc
taccgcctcaagcaggaagtccagatcaccgagatcccggccgaccagcccgtcgagacg
ttgctcgtcgacggcaatcgccccacccatcaggtgtcggtgttcctcgaggtcgagggt
gctgcacactacctgcctgcgtacgccggcaatctcgacatcatgacgtccgccggaatg
cagatcgcggagcgcatcgcccagcagaaggaagcaaccaagtga

DBGET integrated database retrieval system