KEGG   Rhodococcus erythropolis CCM2595: O5Y_27510Help
Entry
O5Y_27510         CDS       T02806                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rey00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    O5Y_27510
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O5Y_27510
   00650 Butanoate metabolism
    O5Y_27510
  Amino acid metabolism
   00360 Phenylalanine metabolism
    O5Y_27510
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O5Y_27510
   00622 Xylene degradation
    O5Y_27510
   00621 Dioxin degradation
    O5Y_27510
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     O5Y_27510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5972458..5973402
Genome map
AA seq 314 aa AA seqDB search
MSKVKVAIIGSGNIGTDLMIKVLRNSDYLEMGAMVGIDPASDGLARAARLNVPITAEGVE
GLIGLPNFDEIEIVFDATSAKAHVANNARLAPLGKRMIDLTPAAIGPYVVPAVNADEHLD
APNVNMVTCGGQATIPMVAAVSRVVPVAYAEIVASIASKSAGPGTRANIDEFTETTSEAI
VAVGGARRGKAIIILNPAEPPLIMRDTVFCLVDAPDPAVHEEIRQSIEKMVGDVSAYVPG
YRLKQEVQITEIPADQPVETLLVDGNRPTHQVSVFLEVEGAAHYLPAYAGNLDIMTSAGM
QIAERIAQQKEATK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcaaggtcgcgatcatcggatcgggcaacatcggcacggatctgatgatc
aaggtgctgcgcaactccgactacctggagatgggcgcgatggtcggcatcgacccagcg
tcggacggcctcgcccgcgcagcgcgtctgaacgtgccgatcacggctgaaggtgtcgag
ggtttgatcggtctgccgaacttcgacgagatcgagatcgtcttcgacgccacctcggca
aaggctcacgtcgccaacaacgcgcggctggctcccctcggcaagcgcatgatcgacctg
acgcctgccgccatcggcccgtacgtcgtgccggccgtcaacgcagacgagcacctggac
gcacccaacgtcaacatggtgacgtgtggtggccaggccacgatcccgatggttgcggct
gtttctcgggtcgtcccggtggcgtatgcggagatcgtggcgtccatcgcctcgaagtcc
gccggtcccggaacgcgcgccaacatcgacgagttcaccgagaccacatccgaggcgatc
gtggcagtcggcggcgcccgccgcggcaaggccatcatcatcctcaaccccgccgagccg
ccgctcatcatgcgcgacacggtgttctgcctcgtcgacgccccggacccggctgttcac
gaggagatccgtcagtccatcgagaagatggtcggcgacgtctccgcctatgttccgggc
taccgcctcaagcaggaagtccagatcaccgagatcccggccgaccagcccgtcgagacg
ttgctcgtcgacggcaatcgccccacccatcaggtgtcggtgttcctcgaggtcgagggt
gctgcacactacctgcctgcgtacgccggcaatctcgacatcatgacgtccgccggaatg
cagatcgcggagcgcatcgcccagcagaaggaagcaaccaagtga

DBGET integrated database retrieval system