KEGG   Rhodococcus erythropolis CCM2595: O5Y_27510Help
Entry
O5Y_27510         CDS       T02806                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rey  Rhodococcus erythropolis CCM2595
Pathway
rey00360  Phenylalanine metabolism
rey00362  Benzoate degradation
rey00620  Pyruvate metabolism
rey00621  Dioxin degradation
rey00622  Xylene degradation
rey00650  Butanoate metabolism
rey01100  Metabolic pathways
rey01120  Microbial metabolism in diverse environments
rey01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rey00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O5Y_27510
   00650 Butanoate metabolism
    O5Y_27510
  Amino acid metabolism
   00360 Phenylalanine metabolism
    O5Y_27510
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O5Y_27510
   00622 Xylene degradation
    O5Y_27510
   00621 Dioxin degradation
    O5Y_27510
Enzymes [BR:rey01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     O5Y_27510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGT95319
Position
5972458..5973402
Genome map
AA seq 314 aa AA seqDB search
MSKVKVAIIGSGNIGTDLMIKVLRNSDYLEMGAMVGIDPASDGLARAARLNVPITAEGVE
GLIGLPNFDEIEIVFDATSAKAHVANNARLAPLGKRMIDLTPAAIGPYVVPAVNADEHLD
APNVNMVTCGGQATIPMVAAVSRVVPVAYAEIVASIASKSAGPGTRANIDEFTETTSEAI
VAVGGARRGKAIIILNPAEPPLIMRDTVFCLVDAPDPAVHEEIRQSIEKMVGDVSAYVPG
YRLKQEVQITEIPADQPVETLLVDGNRPTHQVSVFLEVEGAAHYLPAYAGNLDIMTSAGM
QIAERIAQQKEATK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtcaaggtcgcgatcatcggatcgggcaacatcggcacggatctgatgatc
aaggtgctgcgcaactccgactacctggagatgggcgcgatggtcggcatcgacccagcg
tcggacggcctcgcccgcgcagcgcgtctgaacgtgccgatcacggctgaaggtgtcgag
ggtttgatcggtctgccgaacttcgacgagatcgagatcgtcttcgacgccacctcggca
aaggctcacgtcgccaacaacgcgcggctggctcccctcggcaagcgcatgatcgacctg
acgcctgccgccatcggcccgtacgtcgtgccggccgtcaacgcagacgagcacctggac
gcacccaacgtcaacatggtgacgtgtggtggccaggccacgatcccgatggttgcggct
gtttctcgggtcgtcccggtggcgtatgcggagatcgtggcgtccatcgcctcgaagtcc
gccggtcccggaacgcgcgccaacatcgacgagttcaccgagaccacatccgaggcgatc
gtggcagtcggcggcgcccgccgcggcaaggccatcatcatcctcaaccccgccgagccg
ccgctcatcatgcgcgacacggtgttctgcctcgtcgacgccccggacccggctgttcac
gaggagatccgtcagtccatcgagaagatggtcggcgacgtctccgcctatgttccgggc
taccgcctcaagcaggaagtccagatcaccgagatcccggccgaccagcccgtcgagacg
ttgctcgtcgacggcaatcgccccacccatcaggtgtcggtgttcctcgaggtcgagggt
gctgcacactacctgcctgcgtacgccggcaatctcgacatcatgacgtccgccggaatg
cagatcgcggagcgcatcgcccagcagaaggaagcaaccaagtga

DBGET integrated database retrieval system