KEGG   Rhodococcus fascians: A3L23_02150Help
Entry
A3L23_02150       CDS       T04328                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rfa  Rhodococcus fascians
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rfa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3L23_02150
   00630 Glyoxylate and dicarboxylate metabolism
    A3L23_02150
   00640 Propanoate metabolism
    A3L23_02150
   00650 Butanoate metabolism
    A3L23_02150
  Lipid metabolism
   00071 Fatty acid degradation
    A3L23_02150
   00072 Synthesis and degradation of ketone bodies
    A3L23_02150
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3L23_02150
   00310 Lysine degradation
    A3L23_02150
   00380 Tryptophan metabolism
    A3L23_02150
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3L23_02150
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3L23_02150
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A3L23_02150
Enzymes [BR:rfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3L23_02150
Exosome [BR:rfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3L23_02150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2235990..2237525
Genome map
AA seq 511 aa AA seqDB search
MSSVRHEASTVDPRRVPVIVAIGETSGRGEPMGVEPMELITRAATEALQDSPTSEPWIRR
ADSITFCHIASWAYASPAAALARRFGATPTDVFDAPIGGQWPARLLDRAASRIASGESTV
AVIAGGEAQASMGALVKAGREPVRDGGWSADPGGPPTFDLDQLGSAAMQDAGLITPVRIY
PLFESRFRFEAGLDPESRLAECSDLYAEFSVVAQENPYSWNGRVRTAADIGTPSPKNRIV
CEPYPLSMNAMPFVDQAACIVVTSLAEARERGVPEGDLVFVWGGAGAEDSVDILDRSDFG
RSPAMEDAMDRALRAAEIGVEQLDVVDVYSCFPIVPTLATRHLGTPKSLVPSVTGGHSSF
GGPLSSHSLHSITASVREIRGGKNCALVHANGGYMTYHHSVLLGGDQHPQGYVGNPEPAV
LTPDPPPRAPVQDGTLVVETVSVEHSRQQEPNQGFVVARDERGRRVAAQTAPGDTASARA
LSLYRTDPAREIIGTTVTVDTIEGNIRVRSS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagtacgccacgaggcgtcgacggtggatccgagacgtgttccggtgatcgtg
gctatcggtgagacaagcggccgcggcgaacccatgggcgtcgaacccatggaactgatc
acgcgcgctgccaccgaggcactccaggattcgccgacgtcggagccgtggattcgcaga
gcggacagcatcacgttctgccatatcgccagctgggcttacgccagtcccgccgctgcg
ctggcccgtagattcggtgccacccccacagatgtgttcgacgcgccgatcggtggtcag
tggcccgcgcgccttctcgaccgcgcagcctcgcgcattgcgtccggggagtcgacggta
gcggtgatcgcgggcggtgaagcgcaggcctcgatgggtgccttggtcaaggccgggcga
gagcccgtgcgggatgggggatggagcgcggacccgggaggtccgcccaccttcgacctc
gatcaactcggaagtgccgcaatgcaagacgccggactgatcactccggttcggatctat
cctttgttcgagagccgcttcagattcgaggccggactggatccggagtctcgactggcc
gagtgcagcgacctgtatgcggagttttccgttgtcgcccaagagaacccgtactcgtgg
aacgggcgagtgcggacggctgccgacatcggcacgccgtcgccgaagaaccgcatcgtg
tgcgagccgtatccgttgtcgatgaacgccatgcccttcgtcgaccaggcggcgtgcatc
gtggtgaccagcttggccgaagcccgagaacgcggtgtccccgagggcgacctcgtgttc
gtctggggcggtgcgggtgccgaggattcggtcgacattctcgaccgcagcgatttcggc
cggtctccagcgatggaggatgcgatggaccgagccttgcgcgccgcagagatcggagtc
gaacaactcgacgtggtcgacgtatacagctgcttcccgatcgtgccgaccctcgccacc
cgacacctcggaacgccgaaatcattggtacccagtgtgaccggtggtcattcgtccttc
ggtggtcccctcagtagtcattcgctgcattcgatcaccgcatccgtccgcgagattcgc
ggcggcaagaactgcgcactggtgcacgcgaacggtggctatatgacgtatcaccactcg
gtgctgctcggtggcgaccagcacccacagggctacgtaggaaatcccgaacccgcagtg
ctgacgccggatccaccgcctcgtgcacctgtacaggacgggactctcgtggtggagaca
gtgtccgtcgagcattctcggcagcaggaaccgaaccaggggttcgtcgtcgcgagagac
gagcgcgggcgacgcgtcgccgcacagacggcacccggggacacggccagcgcccgtgcg
ctgtctctgtatcgaaccgacccggcacgcgaaatcatcgggaccacagtcactgtcgac
accatcgaggggaacatccgtgtccgaagcagctag

DBGET integrated database retrieval system