KEGG   Rickettsia felis: RF_0038Help
Entry
RF_0038           CDS       T00252                                 

Definition
dihydrofolate reductase FolA (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rfe  Rickettsia felis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RF_0038
   00670 One carbon pool by folate
    RF_0038
Enzymes [BR:rfe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     RF_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(39114..39458)
Genome map
AA seq 114 aa AA seqDB search
MKNRKIIGIMACDPQGVIGNKGQMPWSYTKEFEYFYQTVKNNIIVMGRKTFDSIPAKILK
NCICIVFSRNTPLQSYNNRTLRKLAYREEFEGDTERRTAAYVRIRVPDRRTNYP
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagaaaaatcatcggtataatggcatgtgacccacaaggggtgataggtaat
aaaggtcagatgccttggtcttatactaaggagtttgaatatttttatcagacggtaaaa
aataatattatagtcatgggacgaaaaacctttgactctatacctgcaaagattttaaaa
aattgtatttgtattgttttttcaagaaatacaccgttacaatcttataataatagaact
cttcggaaactcgcttatagggaggaatttgaaggagacacggaacgcagaaccgcagcg
tacgtgaggattcgagtaccggatcgacgtacaaattacccctag

DBGET integrated database retrieval system