KEGG   Rickettsia felis: RF_0039Help
Entry
RF_0039           CDS       T00252                                 

Gene name
folKP
Definition
folate synthesis bifunctional protein (EC:2.5.1.15 2.7.6.3)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
rfe  Rickettsia felis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RF_0039 (folKP)
Enzymes [BR:rfe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RF_0039 (folKP)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     RF_0039 (folKP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(39448..40836)
Genome map
AA seq 462 aa AA seqDB search
MRTEGLTKRRSQFFKFSEYTMIYISISSNLGNRLLNIKKALNLLKSCDFRLLKQSIIFET
QVILPPNADKAWNKSYLNMVVQGKSTLTPSKLLIELKKIEKQLGRADSYDKWSPRVIDLD
ILLWSNCHIDLPDLKIPHPELLNRPFLIHLIAGLSLECRYTCPTNNFYNNKTFAEIAHLI
ENQGVIRSLVLNPQFVGILNITPDSFSDGGLNFHKEDAVRNFVRLINEGATIIELGSQST
RPSALIINEDEEYARLENVLEELREVIKEKEVIVSINSFTPEVIKNVLKKYPISCINLVK
NNLDNYTLRLIADYNCKIITMHSLAVPPQKQKCLDFDNSPLANLNIWAEQETTKLEKYGF
DRKNIILDPGIGFGKSVYQNLYILQHMKKFKNLGCEILVGHSRKSYISAFYNSKASERDL
ETIAISKYLTEHGADYLRVHNVIEHQRFFVTDHMIKLSSHEK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccgaaggacttacaaagcgacgaagtcaatttttcaaattcagcgagtatact
atgatttatatttctataagcagtaatttaggtaatagacttttaaatattaaaaaagct
ttaaatttactaaaaagctgtgattttagattgcttaagcaatctattatttttgaaaca
caagttattctaccacctaatgcagataaagcttggaataagtcatatttaaatatggtg
gtgcagggtaaaagtactttaacgcctagtaaacttctaattgagcttaaaaagattgaa
aaacaactaggtcgagcagactcttacgataaatggtctccaagagttattgacttagat
atcctactttggagtaattgccatatagatttgcctgatttaaaaataccgcatcctgaa
ttattaaacagaccgtttcttattcatctaattgcaggtttaagtttggaatgtcgttat
acatgtccgactaataatttttacaacaataaaacctttgcagaaatagcacatttaatt
gagaatcaaggagttatacgctctcttgttttaaatcctcaatttgtcggtattttaaat
attactcctgattctttttctgatggaggattaaattttcataaagaagatgccgttaga
aattttgtacgcttgataaatgaaggggctacaataattgagcttggatcacaatcaaca
cgtccttctgctttaattattaatgaagatgaagaatatgcaaggcttgagaatgttctt
gaagagcttagggaagttataaaggaaaaagaagttatagtcagtattaatagttttact
cctgaagtaattaaaaatgttttaaaaaaataccctatttcctgtataaatttggttaaa
aataatctagataattatacattacgattaattgccgattataattgtaaaattattact
atgcactcattagccgttccaccgcaaaaacaaaaatgtcttgatttcgataactctccg
cttgctaacttaaatatatgggcagagcaagaaacaacaaaattagaaaaatatggattt
gatagaaaaaatatcattcttgatcctggaattggttttggaaaatccgtttatcaaaat
ttatatatattacaacatatgaaaaaatttaaaaatctaggatgtgagatattggtagga
cactcacgaaaatcttatatttctgctttttataattccaaagcatcggaaagagattta
gaaacaatagcaatatcaaaatatttaacagagcatggagctgattatttacgagtgcat
aatgttatagagcatcaaagattttttgtaacagaccatatgattaaactttcatctcat
gaaaaatag

DBGET integrated database retrieval system