KEGG   Rickettsia felis: RF_0145Help
Entry
RF_0145           CDS       T00252                                 

Gene name
aco1
Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rfe  Rickettsia felis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rfe01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rfe01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161139..162332
Genome map
AA seq 397 aa AA seqDB search
MLSKLNKPALFALIFYPIFIISLVVKYSFDYGIGLTEAIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQDQDPHTPLKFDNKFLGF
MWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIAAFMNIVVPLFIGYLVGG
TILSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKQYYKGTAGDIWWMTLFLLGENWHN
YHHAFPSDYRNGAKWYHFDVHKWIIFLMSKIGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSFVEIQESLKNLAEQVSSATQI
TEKPSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKVSN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagcctgctttatttgctttaatattttatcctatttttatt
atatctcttgtagttaaatattcgtttgattatgggataggactaactgaagctattttt
ataattgctagttattatattaataatattaccgttgggattggtttgcataggttatgg
tctcataatgcctataaaataaataaatatgccgagtttgtcttaattatgctgtctgca
ggaacattacaaggaccggctttatcttgggcatcgaatcattataaacatcatagatat
acggatcaagaccaagatccgcatactcctttaaaatttgacaataaatttttaggcttt
atgtggtctcatataggatggatgctagttggaagcggtagctataagtctattgatcgc
attacttgggctaagcacgggaaaaacaatttattaaaatggcagctaaaatattattgg
caaatagcagcttttatgaatattgtcgtgcctttatttatcggttacttagtcggcggt
actatattatcggcatatgcaggatttttatttatggggctcggtagattcctacagcag
caagcaaccttctgtgttaattctttatgccactttgccggtagtaaacaatattacaaa
ggtaccgctggagatatttggtggatgactctatttttactaggtgaaaattggcataat
taccatcatgcttttccttcagattatcgtaacggtgcaaaatggtatcattttgacgtt
cacaaatggataatatttttaatgagtaaaataggtttagcttcagaacttgaacgtact
acaaaagtacgtatacaggcaaaaatgcaagaaactttaagctatcttagtgaaaaacaa
aagcaaaaattgactttaatgcaaactaaaatagatcatttattagaaaatctatgctta
aaaattaaagagcttgaagaatcatctattactattaaagaacaatttaagaaatctttt
gtagaaatacaagaatcacttaaaaatttagcagagcaagtaagttctgcaacgcaaata
acagaaaaaccttcggaaaaattactaaaaatagttaataaaaaaattattgatgccgaa
caatctatttataagctgtataatcaattaaataccttaaaggtatctaattaa

DBGET integrated database retrieval system