KEGG   Rickettsia felis: RF_0480Help
Entry
RF_0480           CDS       T00252                                 

Definition
hypothetical protein
Organism
rfe  Rickettsia felis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513992..514876
Genome map
AA seq 294 aa AA seqDB search
MFKRSLFILLLLAASLVKAEIIEVDSLNKIKQDFKENYNKNYVPQDLLVVTVLDEFLFKS
LVPIGEQIDKDIYLTLTPLLRNINKNSKAIYIDQLILTNDSYKKELQESDFPNFVNEMSN
SKIPIIAVNDGFTGNFNNIPKFEIWFADYLKKNFNIDFSNSFPNNNYIIFNNLDSFANTY
PVFYKGILTSNNISKAEMMLNFLIQVGFMPKAFIIISNNIELLKSMEFQLNSYSSNILFI
GYHYNNKNTPENKDAAYYTKIINDLISQINKIKRNNPPLKTNKIKDKNPYDKNQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatctttattcatcttactattacttgctgcttccttagttaaagcagaa
attatagaagtggatagtttaaataaaataaaacaagattttaaagaaaattataataaa
aattatgtacctcaggatttattagtagtaacggttttagatgaatttttgtttaagtct
ttagtgcctataggtgaacaaattgacaaagatatttatcttacactaactcctcttttg
cgtaatattaataaaaattcaaaagctatttatatagatcaattgattttaactaatgat
agttataagaaagaattacaagaatctgattttccaaattttgtaaatgaaatgagtaat
agtaaaatccctataatagccgtaaatgatggatttaccggtaattttaataatattcct
aaatttgaaatatggtttgctgattatttaaagaaaaatttcaatattgatttttcaaat
agttttccaaacaataattatattatttttaataatttagacagttttgctaatacttat
ccggtattttataagggtatattgacgagtaataatatatcgaaagcggaaatgatgctc
aatttccttattcaagtgggatttatgcctaaagcttttataataattagcaataacata
gaattattaaaatcaatggagtttcaacttaatagttatagttctaatatattatttatt
ggttatcattataataataaaaataccccggaaaataaagatgctgcatattatactaaa
atcattaatgatttaatatctcaaataaataagataaaaagaaataatccgcctctaaaa
actaacaagataaaagataaaaatccttatgataaaaatcaataa

DBGET integrated database retrieval system