KEGG   Rickettsia felis: RF_0482Help
Entry
RF_0482           CDS       T00252                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rfe  Rickettsia felis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RF_0482 (cysQ)
Enzymes [BR:rfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     RF_0482 (cysQ)
Transfer RNA biogenesis [BR:rfe03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    RF_0482 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
515934..516710
Genome map
AA seq 258 aa AA seqDB search
MNNNLIAALKDLIINTGRVALDIKKAGILTDIKSDGSVVTNADKEISKVIYQSLQVLTPK
IAIVCEEQPLPILSSDTFWLIDPIDGTRSYVNGKSTYTVNIGLIENGLPTIGLIYHPETA
KLYYTDVQGRLKIEQNSKEIFVNHEPKHEELNAVIGFYNSNKDTKEFLSKYSFGQINAIG
SSIKLCLIAEGAADIYPKFGQTMEWDIAAGHALIKAGGGNILDCDGQEITYGKENFANPN
FFACSKYWLKREAVFRGY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacttaatagccgctttaaaagatttaattattaataccggtagggttgca
ctagatataaaaaaggcaggaatattgactgatattaaatcagatgggtcagtagtcact
aatgccgataaggaaattagtaaagtaatttatcagtctctacaagtcttaacccccaaa
atagctatagtatgtgaagagcagccgctacctatattaagcagtgatactttttggtta
atcgatcctattgacgggacgcggagctatgtaaacggtaaaagtacatatacggtaaat
atagggcttattgaaaacggtcttccaactatcggcttgatatatcaccctgaaacagca
aagctatattataccgatgtacaggggcggttaaaaatcgaacagaattctaaagaaata
tttgttaatcatgaacctaaacatgaagagcttaatgcggtaataggtttttataattca
aataaagatactaaagaatttttaagtaaatattcattcggtcaaataaatgcaataggc
agttcaattaaactatgcttaattgctgaaggagcagctgatatatatccaaaattcggt
caaactatggaatgggacatagcggcaggtcatgctttgattaaagccggcggcggtaat
attttagattgtgacggacaagaaattacttacggtaaagaaaattttgctaaccccaat
tttttcgcttgtagtaaatattggttgaaaagggaggctgtatttcgtggatactaa

DBGET integrated database retrieval system