KEGG   Rickettsia felis: RF_0599Help
Entry
RF_0599           CDS       T00252                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rfe  Rickettsia felis
Pathway
rfe00790  Folate biosynthesis
rfe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RF_0599 (folE)
Enzymes [BR:rfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RF_0599 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF EIF_2_alpha
Motif
Other DBs
NCBI-ProteinID: AAY61450
UniProt: Q4ULX3
Position
643705..644277
Genome map
AA seq 190 aa AA seqDB search
MSKPTREEAKEAVRTLLKFIGEDPTREGLLKTPDRVVNSYTEIFSGYGKDVAEILNTKFY
DTCNFQDFILLKDIKFTSFCEHHMLPFIGTVDIAYIPDNCIVGISKLARIVNAFSKRLQI
QEKMTVQIAESVQENLKPLGVAVKISALHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYR
YDFLNLTAKR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccaactagagaagaagctaaagaagcggtaagaacgttactaaaattcatt
ggtgaagatccaactagagaagggttgcttaaaacccctgatagagtggttaacagctat
acggaaatattttccggttatggaaaggatgtagctgaaatattaaatacaaaattttac
gatacttgtaattttcaggattttatcttactgaaagatataaaattcacctctttttgt
gaacatcatatgttaccttttatcggtacggtggatatagcttatattcctgataattgt
attgtcggcataagcaagttagcacgaatagtaaatgccttttctaaaagattacaaata
caagaaaagatgacggtacaaatagccgaaagcgtacaggagaatttaaagccgcttggc
gttgccgttaagatttctgctttacatagttgtatgtcgatgcgtggagtgatgcaagat
aatagtgttatgaacactatgcattatacagggatatttgccgagcagcagaaatatcgc
tatgattttctgaatcttactgctaaaaggtaa

DBGET integrated database retrieval system