KEGG   Rickettsia felis: RF_0665Help
Entry
RF_0665           CDS       T00252                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rfe  Rickettsia felis
Pathway
rfe00020  Citrate cycle (TCA cycle)
rfe00640  Propanoate metabolism
rfe01100  Metabolic pathways
rfe01110  Biosynthesis of secondary metabolites
rfe01120  Microbial metabolism in diverse environments
rfe01130  Biosynthesis of antibiotics
rfe01200  Carbon metabolism
Module
rfe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rfe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RF_0665 (sucC)
   00640 Propanoate metabolism
    RF_0665 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RF_0665 (sucC)
Enzymes [BR:rfe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RF_0665 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AAY61516
UniProt: Q4ULQ7
Position
complement(712858..714018)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSIVFDRLASC
ITFIASTEGGVDIEEVAEKTPEKIVKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYNAFVETDAAQIEINPLIVQTDGNLLALDAKITFDDNGLFKHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGKEI
LSNSGLEIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggcgtacctacttcc
accggactagttgttacgaaaaccgaaaagattaatgaaaccatagataaattaaatacg
gaagtatatgtggttaaagcacaaatacacgctggcggcagaggtaaagccggcggcgtt
aaggttgttaagagtaaagaagaagccaagaaagttgctcatgacatgtttggtattaat
ttagtaacgcatcaaacaggacctcaaggacaaaaagtaaaccgtctttatattgaatca
ggttgtgatattttaaaagaatattatttcagtatcgtatttgatagattagctagctgt
attactttcatagcttctaccgaaggaggggttgatattgaagaagtagcagaaaaaact
ccggaaaaaattgttaaattttccgttgatcctgcaactggtttacaagattttcatatg
cgaggcatagcttatgagttaggctttaaggataaccaagcaaaacagatgaaagaaata
gtaaaatcagtctataatgcttttgttgaaactgatgcagcacaaattgaaatcaacccg
ttaattgtacaaacggacggaaatttactcgctttagacgcaaaaatcacttttgacgat
aacggattattcaaacatccgaatattacagcaatgcgtgatcacgatgaggaagatcct
ttagaaactagagcggcaaatgcaggacttagctatgtaaaaatggacggtaatatcggc
tgtatggttaacggtgcaggtcttgctatggctaccatggatattattaagctttacggt
gcgtcacctgcaaatttcttagatgttggcggcggtgctgatcgtgagcgtgtaaaagaa
gctttaaaaataattttatctgataaagaagtgcaaggaatcttagttaatattttcggc
ggtattatgcgttgtgatattatagcggaagggattattgcagcagcaaaagacataggt
ataaaagtaccgttagtggttcgtttagccggtacaaacgttgaaaaagggaaagaaatt
ttatcaaattctggtttagaaataataccggcacatgatttagcagatgctgcaaataag
atagttgaagcgatacggtaa

DBGET integrated database retrieval system