KEGG   Rickettsia felis: RF_0890Help
Entry
RF_0890           CDS       T00252                                 

Gene name
fadB
Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rfe  Rickettsia felis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RF_0890 (fadB)
   01212 Fatty acid metabolism
    RF_0890 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RF_0890 (fadB)
   00650 Butanoate metabolism
    RF_0890 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    RF_0890 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    RF_0890 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RF_0890 (fadB)
   00310 Lysine degradation
    RF_0890 (fadB)
   00380 Tryptophan metabolism
    RF_0890 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RF_0890 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RF_0890 (fadB)
   00281 Geraniol degradation
    RF_0890 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    RF_0890 (fadB)
Enzymes [BR:rfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RF_0890 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RF_0890 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RF_0890 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(951544..953706)
Genome map
AA seq 720 aa AA seqDB search
MQNEIKKVCVIGSGVMGSGIAALIANSSHKVVLLDIIAKDSDDPNKIVKTAKENLHKQKP
PPLSFPDKVNFITIGNLEHDLELIRDCDLVIEVIVEKLEIKHQLYNKIIPYLKEDAIIAS
NTSTLPLKRLKENLPDNIKSRFVITHFFNPPRYMELLELIIDSMVKFEVIERVSGFLTKT
LGKTIVKCNDTPGFIANRVGCFLLELVARKAISQKLDFVALDKIFTICLGLPSTGIFGLY
DLIGHDVMKLISSSLLAALPANDAYHKIYVNTPVLDKMIEKKLIGRKGEGGFYRLSVSNG
KKIKEVININDLSYSSVQKVDISFNNLDELLVSDSVYGKIFTEIITEFYVYLASLVPSVT
DNIYDIDAAMKLGYSWKYGPFELLTIAAKDGWNSVIKNADLMHIPLPQYLGNKEYQKIDK
QKFNSHKDILQESQIVLENDSAKLINYRENFIFVITTKMNCLNHNVFYLLQEAASKAEKD
GKNLYIYPQGNNFSAGADLKLLLSYIEDGNFHDLENLLKLGQQTMLHLKYSGVHIISCAK
GVALGGGCELLLYSSYIVANQELNAGLVELGVGLIPGWGGVTEMFVRSKGDKTKLIRNVR
NIIEQNKTSSADYFKSDYDVESMHVNMNKHYILDEALKLNLSKKIVPIPHKITLPKINLA
TEIDTSKYNDLQNKVLSKFQNIIDKHPDTNEEELLGYEREIFLELAKDPKTIEKLKAIVK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaagtttgtgttatcggttcgggagtaatgggttcagggatt
gcagcgttaattgctaattcctctcataaagtagtgctgcttgatattatcgctaaagat
tccgatgatccgaataaaatagttaaaaccgctaaagaaaatttgcataaacaaaaacct
cctcctttgtcttttccggataaagtaaatttcattaccatcggcaatttagaacatgat
ttagaattaattagggattgtgatttagtaattgaagttattgttgagaagctagaaatc
aaacaccaattatataataaaattattccttatcttaaagaagatgcaattattgcttct
aatacctctacattacctcttaaaagactcaaagagaatttaccggataatattaaatct
agattcgttattacgcatttcttcaatccgccaagatatatggaactgcttgaattaatt
atagactcgatggtaaagtttgaagtaatagaaagagtatcaggattcttaacgaaaact
cttggtaagactatagtaaaatgtaatgatacgcctggctttattgctaatagagtaggg
tgttttttacttgaattagtagctcgcaaagcgataagtcaaaagcttgattttgtagct
ttagataaaatatttactatatgtttggggttgccgagtaccggaatttttggtttatat
gatctaatcgggcatgacgtaatgaagttaatatcaagctcattacttgccgcacttcct
gcaaatgatgcttatcataaaatatatgtaaatactcctgttctcgataagatgatagag
aagaagttaattggacgtaagggtgaaggtgggttttatcgtttatcggtatcaaacggc
aaaaagattaaagaagttatcaatataaacgatttatcatatagttctgttcaaaaagta
gatatttcatttaataatcttgacgagttactagttagcgattcggtttacggtaaaatt
tttactgaaattatcacggaattttatgtttatttagcaagtttagtaccatctgtaacc
gataatatctatgatatcgatgctgctatgaagcttggttacagctggaaatacggtcca
tttgaattattgaccatagcagctaaagacggctggaattcggtaattaaaaatgccgat
ttaatgcatatcccgcttccgcaatatttaggcaataaagaatatcaaaaaatcgataaa
caaaaatttaattctcacaaagatattttacaagaaagtcagatagtattagaaaacgat
tctgcaaagctaataaattatcgtgagaatttcatttttgttattactacaaaaatgaat
tgtttaaaccataatgtgttttatttactgcaagaagcagcaagtaaagccgaaaaggac
ggcaaaaatctttatatttatccgcaaggaaataatttttctgccggtgcggatttaaag
cttcttctttcttatattgaagacggtaattttcatgatctagagaatttactaaagctg
ggacagcaaactatgctgcacttaaaatattctggggttcatattattagttgtgctaaa
ggagtagcacttggcggagggtgtgagctgctattgtactcaagctatattgtggcaaat
caggaacttaacgccggacttgtagaacttggagtcggtttaataccgggatggggcggt
gttactgaaatgtttgtacgaagcaagggagataaaactaaattaattagaaatgtcaga
aatattatagagcagaataaaacaagttcagccgattattttaaatcagattatgatgta
gagagtatgcacgtaaatatgaataagcattatattttagatgaagctttaaaattaaac
ctatctaaaaagatagtaccgattccgcataaaattactttgcctaaaataaatttagca
acagaaatagatacatcaaaatataacgatctacaaaataaggtacttagcaaattccaa
aatattattgataagcatcctgacacaaatgaggaagagttgcttggctatgagcgggaa
atatttttagaacttgcaaaagatcctaagactatagaaaagttaaaagcgattgtgaag
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system