KEGG   Rickettsia felis: RF_0923Help
Entry
RF_0923           CDS       T00252                                 

Definition
ankyrin repeat-containing protein
Organism
rfe  Rickettsia felis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(983717..984652)
Genome map
AA seq 311 aa AA seqDB search
MFKKWLQPSNEELIKAIYVKNEAEAQKLIAKMDILELSKIYIDNTALIWAVDKGLEKVCE
MLIPKMSEQAINHVTNNGNTALTLAASKGLEKICELLIPKMSPQAINHVTDNGNTALTWA
AWKDLEKICEMLIPKMSPQAINQVTNNGNTALILAAWKGLEKICKILIPKMFEQAINQVT
NKGCTALTLAADKDLKKIYELLINKMSIDAINHTLTSSHKEVKKFIQEKISYNNILAEKL
ALFLKESFLGKGKDNINNFVKMISAAKFYKIVNKKLLTEYLQKQEVDNSKFIIEEMNNFI
KTHSFTIARIC
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaatggttgcaaccctcaaatgaagagttaataaaagcaatatacgtaaaa
aacgaagctgaagcacagaaattaattgctaaaatggatattctagagttaagcaaaatt
tatattgataatacagctttaatttgggctgttgacaaaggcttagaaaaagtttgtgaa
atgcttattcctaaaatgtctgagcaggctattaatcacgttactaataatggtaatacg
gctttaactttggctgctagtaaaggcttagaaaaaatttgcgaattgcttatacctaaa
atgtcaccacaggctattaatcacgttactgataatggcaatacggctttaacttgggct
gcttggaaagacttagaaaaaatttgcgaaatgcttattcctaaaatgtcaccacaggct
attaatcaagttactaataatggcaatacggctttaattttggctgcttggaaaggctta
gaaaaaatttgtaaaattcttatacctaaaatgttcgagcaggctattaatcaggttact
aataaaggctgtacggctttaactttggctgctgataaagacttaaaaaaaatttacgaa
ttgcttattaacaaaatgtctattgacgctattaatcatacattgacaagttctcataaa
gaggtaaaaaaatttattcaagaaaaaatctcatacaataatattttagcagagaaatta
gctttatttttaaaagaatcttttttaggtaaaggtaaagataatataaataattttgtt
aaaatgataagtgctgcaaaattttataaaatagtaaataagaagttattaacagaatat
ttacaaaagcaagaagttgacaactccaaatttataatagaggaaatgaacaacttcatt
aaaacacattcttttactattgctagaatatgttaa

DBGET integrated database retrieval system